DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5861 and tmem147

Sequence 1:NP_609789.1 Gene:CG5861 FlyBaseID:FBgn0015338 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001005017.1 Gene:tmem147 XenbaseID:XB-GENE-970269 Length:176 Species:Xenopus tropicalis

Alignment Length:176 Identity:69/177 (39%)
Similarity:114/177 (64%) Gaps:7/177 (4%)


  Fly    49 MLVLATFFYSDAPS---SSGEFNFFAEILRCSMDIADLLGFALILSRIPGKGHSKLITAGLGWAT 110
            ||.|||||    |:   :.|.::|..|.::.::|:|||||..|::||..|||..|::.|.:||||
 Frog     1 MLFLATFF----PTWEGAVGAYDFIGEFMKATVDLADLLGLHLVMSRNAGKGEYKIMVAAMGWAT 61

  Fly   111 AEVILSRGIMLWVGARGTEFSWIYILKCLESNVLLVQHITTATLIWLFTRHDLNKALKPLVSLLL 175
            ||:::||.:.|||||||.||.|.||...::||:.||.::..|.|:|::||:||....:..|::||
 Frog    62 AELVMSRCLPLWVGARGIEFDWKYIQMSIDSNISLVHYMAVAALVWMWTRYDLPTHYRLPVTVLL 126

  Fly   176 AVTVFKGVWLEGMLHILTIGPWLTVAVKALVAAVIGFCTLHIYSGL 221
            .::::|...::..:||..:|.|..:.:||::..|:....|.::..|
 Frog   127 GLSMYKAFLMDCFVHIFIMGSWTALLLKAVITGVLSLSCLTLFVSL 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5861NP_609789.1 DUF2053 2..160 CDD:286808 53/114 (46%)
tmem147NP_001005017.1 DUF2053 <1..108 CDD:313060 52/111 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195540590
eggNOG 1 0.900 E1_KOG3236
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3428
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006285
OrthoInspector 1 1.000 T1059637
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3948
TreeFam 1 0.960
109.790

Return to query results.
Submit another query.