DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5861 and tmem147

Sequence 1:NP_609789.1 Gene:CG5861 FlyBaseID:FBgn0015338 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_001002484.1 Gene:tmem147 ZFINID:ZDB-GENE-040718-187 Length:225 Species:Danio rerio

Alignment Length:222 Identity:108/223 (48%)
Similarity:153/223 (69%) Gaps:8/223 (4%)


  Fly     1 MTLYHFGNCVAL-LTPYYFTYKYSGLSEYGAFWKCVQAGGIYIFTQLVKMLVLATFFYSDAPS-- 62
            |||:|||||.:| ..||:.|||.||||||.|||:|||||..|:|.:|.|||.|||||    |:  
Zfish     1 MTLFHFGNCFSLAYFPYFITYKCSGLSEYNAFWRCVQAGATYLFVRLCKMLFLATFF----PTWE 61

  Fly    63 -SSGEFNFFAEILRCSMDIADLLGFALILSRIPGKGHSKLITAGLGWATAEVILSRGIMLWVGAR 126
             .:|.::|..|.::.::|:|||||..|::||..|||..|::.|.:||||||:|:||.|.||||||
Zfish    62 GGAGVYDFVGEFMKATVDMADLLGLHLVMSRNAGKGEYKIMVAAMGWATAELIMSRCIPLWVGAR 126

  Fly   127 GTEFSWIYILKCLESNVLLVQHITTATLIWLFTRHDLNKALKPLVSLLLAVTVFKGVWLEGMLHI 191
            |.||.|.||....:||:.||.:|..|.::|:|||:||.|:.:..|::||.:.|:||..:|..:|:
Zfish   127 GIEFDWKYIQMSFDSNISLVHYIAMAAVVWMFTRYDLPKSFRLPVAILLGLCVYKGFLMELFVHV 191

  Fly   192 LTIGPWLTVAVKALVAAVIGFCTLHIY 218
            ..:|.|..:.|||::...|..|:|.::
Zfish   192 FLLGSWTALLVKAVLTGAISLCSLFLF 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5861NP_609789.1 DUF2053 2..160 CDD:286808 87/162 (54%)
tmem147NP_001002484.1 DUF2053 2..160 CDD:286808 87/162 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195540721
eggNOG 1 0.900 E1_KOG3236
Hieranoid 1 1.000
Homologene 1 1.000 H12330
Inparanoid 1 1.050 227 1.000 Inparanoid score I3391
OMA 1 1.010
OrthoDB 1 1.010 D1388283at2759
OrthoFinder 1 1.000 FOG0006285
OrthoInspector 1 1.000 T1052865
orthoMCL 1 0.900 OOG5_131748
Panther 1 1.100 LDO PTHR12869
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.