DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5861 and ZK418.5

Sequence 1:NP_609789.1 Gene:CG5861 FlyBaseID:FBgn0015338 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_498544.1 Gene:ZK418.5 WormBaseID:WBGene00022734 Length:225 Species:Caenorhabditis elegans

Alignment Length:222 Identity:84/223 (38%)
Similarity:128/223 (57%) Gaps:11/223 (5%)


  Fly     1 MTLYHFGNCVAL-LTPYYFTYKYSGLSEYGAFWKCVQAGGIYIFTQLVKMLVLATFFYSDAPSSS 64
            |:.:||.||.|| ..||:..|||||::||.:.|||..|.|.|:.|||.|:|::||||    |:..
 Worm     1 MSFFHFINCFALAFAPYFIVYKYSGINEYSSIWKCATASGGYLLTQLAKLLIIATFF----PALD 61

  Fly    65 GE-FNFFAEILRCSMDIADLLGFALILSR-IPGKGHSKLITAGLGWATAEVILSRGIMLWVGARG 127
            .| |:...|.|:.|.||.|::|..|:::. :.|||..:.:..||||..|..:..|.::|||||||
 Worm    62 SEGFSIVPEFLKSSADIIDVIGLHLLMTNFLAGKGEVRFVVGGLGWGFAHSVAHRLVLLWVGARG 126

  Fly   128 TEFSWIYILKCLESNVLLVQHITTATLIWLFTRHDLNKALKPLVSLLLAVTVFKGVWLEGMLHIL 192
            |.|:|.::...|:|:..|:..::.|.|.|:.||.. ||.   |||.:||:.||.....:.:.|..
 Worm   127 TAFTWRWVQTSLDSSADLLVIVSLACLTWMITRTP-NKF---LVSPILAMCVFSTFVYQTVQHTF 187

  Fly   193 TIGPWLTVAVKALVAAVIGFCTLHIYS 219
            ::..|..:|.:...:......|:.:||
 Worm   188 SLYGWSLLAFRFAYSIATAILTVVVYS 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5861NP_609789.1 DUF2053 2..160 CDD:286808 67/161 (42%)
ZK418.5NP_498544.1 DUF2053 2..159 CDD:286808 67/161 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195536234
eggNOG 1 0.900 E1_KOG3236
Hieranoid 1 1.000
Homologene 1 1.000 H12330
Inparanoid 1 1.050 155 1.000 Inparanoid score I2890
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1388283at2759
OrthoFinder 1 1.000 FOG0006285
OrthoInspector 1 1.000 T477311
orthoMCL 1 0.900 OOG5_131748
Panther 1 1.100 LDO PTHR12869
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3948
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.