DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG5861 and TMEM147

Sequence 1:NP_609789.1 Gene:CG5861 FlyBaseID:FBgn0015338 Length:227 Species:Drosophila melanogaster
Sequence 2:NP_116024.1 Gene:TMEM147 HGNCID:30414 Length:224 Species:Homo sapiens

Alignment Length:220 Identity:108/221 (49%)
Similarity:149/221 (67%) Gaps:6/221 (3%)


  Fly     1 MTLYHFGNCVAL-LTPYYFTYKYSGLSEYGAFWKCVQAGGIYIFTQLVKMLVLATFFYSDAPS-S 63
            |||:|||||.|| ..||:.|||.||||||.|||||||||..|:|.||.|||.|||||    |: .
Human     1 MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWKCVQAGVTYLFVQLCKMLFLATFF----PTWE 61

  Fly    64 SGEFNFFAEILRCSMDIADLLGFALILSRIPGKGHSKLITAGLGWATAEVILSRGIMLWVGARGT 128
            .|.::|..|.::.|:|:|||:|..|::||..|||..|::.|.|||||||:|:||.|.|||||||.
Human    62 GGIYDFIGEFMKASVDVADLIGLNLVMSRNAGKGEYKIMVAALGWATAELIMSRCIPLWVGARGI 126

  Fly   129 EFSWIYILKCLESNVLLVQHITTATLIWLFTRHDLNKALKPLVSLLLAVTVFKGVWLEGMLHILT 193
            ||.|.||...::||:.||.:|..:..:|:.||:||....:|.|.||:.::|:|...:|..:|:.:
Human   127 EFDWKYIQMSIDSNISLVHYIVASAQVWMITRYDLYHTFRPAVLLLMFLSVYKAFVMETFVHLCS 191

  Fly   194 IGPWLTVAVKALVAAVIGFCTLHIY 218
            :|.|..:..:|:|..::...||.:|
Human   192 LGSWAALLARAVVTGLLALSTLALY 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG5861NP_609789.1 DUF2053 2..160 CDD:286808 89/160 (56%)
TMEM147NP_116024.1 DUF2053 2..155 CDD:313060 88/157 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C195540296
eggNOG 1 0.900 E1_KOG3236
Hieranoid 1 1.000
Homologene 1 1.000 H12330
Inparanoid 1 1.050 223 1.000 Inparanoid score I3479
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1388283at2759
OrthoFinder 1 1.000 FOG0006285
OrthoInspector 1 1.000 T1073555
orthoMCL 1 0.900 OOG5_131748
Panther 1 1.100 LDO PTHR12869
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.770

Return to query results.
Submit another query.