DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GMF and AIM7

Sequence 1:NP_609787.2 Gene:GMF FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_010348.1 Gene:AIM7 SGDID:S000002470 Length:149 Species:Saccharomyces cerevisiae

Alignment Length:142 Identity:37/143 (26%)
Similarity:71/143 (50%) Gaps:22/143 (15%)


  Fly     9 ISNEVLEELKKFRFSKSKNNA--ALILKVD-REKQTVVLDE-------FIDDISVDELQDTLPGH 63
            |..|...::||||.|.::.::  ||.:|:: :....:::||       .|:|:|  ||.:.||.:
Yeast     7 IGTETRNKIKKFRTSTARTDSIKALSIKIEPKPSYEIIVDEDEQEELDEIEDLS--ELAEILPDN 69

  Fly    64 QPRYVIYTYKMVHDDQRISYPMCFIFYTPRD--SQIELQMMYACTKSALQREVDLTRVYEI---- 122
            .||:|:..|.....|.....|:..:::.|..  || |.:|:||.....::.|....::.|:    
Yeast    70 SPRFVLTAYPTTTKDGFKQTPLVLVYWKPMTVVSQ-EWKMLYAGALEMIREECGTFKLIEVSSGL 133

  Fly   123 ---RELDELTEE 131
               .:::||.|:
Yeast   134 EDDSDVEELREQ 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 36/139 (26%)
AIM7NP_010348.1 ADF_gelsolin 7..136 CDD:326633 34/132 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C135381067
eggNOG 1 0.900 E1_KOG1736
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001768
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130100
Panther 1 1.100 LDO PTHR11249
Phylome 1 0.910 0.733 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1785
TreeFam 1 0.960
98.730

Return to query results.
Submit another query.