DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GMF and ADF1

Sequence 1:NP_609787.2 Gene:GMF FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001078247.1 Gene:ADF1 AraportID:AT3G46010 Length:150 Species:Arabidopsis thaliana

Alignment Length:112 Identity:29/113 (26%)
Similarity:59/113 (52%) Gaps:5/113 (4%)


  Fly    19 KFRFSKSK---NNAALILKVDREKQTVVLDEFIDDI-SVDELQDTLPGHQPRYVIYTYKMVHDDQ 79
            |.||.:.|   .:..::.|::.:::.||:::....| :.:|....||..:.||.||.:..|..:.
plant    26 KLRFLELKAKRTHRFIVYKIEEKQKQVVVEKVGQPIQTYEEFAACLPADECRYAIYDFDFVTAEN 90

  Fly    80 RISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELD 126
            .....:.||.:.|..:::..:|:||.:|...:||:|..:| |::..|
plant    91 CQKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQV-ELQATD 136

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 29/113 (26%)
ADF1NP_001078247.1 ADF_cofilin_like 17..149 CDD:200442 29/113 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.