DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GMF and Gmfb

Sequence 1:NP_609787.2 Gene:GMF FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:XP_006251876.1 Gene:Gmfb RGDID:70910 Length:143 Species:Rattus norvegicus

Alignment Length:133 Identity:68/134 (51%)
Similarity:104/134 (78%) Gaps:1/134 (1%)


  Fly     6 ICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQPR-YVI 69
            :||::.:::|:|:||||.|..:|||:|:|:|::|:.|||||.::.:|.|||:|.||..||| :::
  Rat     7 VCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRTFIV 71

  Fly    70 YTYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELTEEWLK 134
            |:||..|||.|:|||:||||.:|...:.|.|||||.:|:.|.:..:||:|:|||..::||||||:
  Rat    72 YSYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLR 136

  Fly   135 AKL 137
            .||
  Rat   137 EKL 139

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 60/122 (49%)
GmfbXP_006251876.1 ADF_GMF-beta_like 9..131 CDD:200439 60/122 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C135361670
eggNOG 1 0.900 E1_KOG1736
Hieranoid 1 1.000
Homologene 1 1.000 H37882
Inparanoid 1 1.050 157 1.000 Inparanoid score I4127
OMA 1 1.010
OrthoDB 1 1.010 D1477747at2759
OrthoFinder 1 1.000 FOG0001768
OrthoInspector 1 1.000 T618771
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11249
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.