DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GMF and gmfg

Sequence 1:NP_609787.2 Gene:GMF FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001035136.1 Gene:gmfg ZFINID:ZDB-GENE-060331-89 Length:142 Species:Danio rerio

Alignment Length:132 Identity:67/133 (50%)
Similarity:102/133 (77%) Gaps:0/133 (0%)


  Fly     6 ICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQPRYVIY 70
            :|::.:.:.|:||||||.|..:|||:::|:|.:||.|||:|..:|||:|||::.||..||||::|
Zfish     7 VCEVDDGLQEKLKKFRFRKETSNAAILMKIDMQKQLVVLEEEYEDISLDELREELPERQPRYIVY 71

  Fly    71 TYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELTEEWLKA 135
            :||:.|.|.|:|||:||||.:|...:.|.|||||.:|:.|.:..:||:::|:|..|:|||:|||.
Zfish    72 SYKLTHGDGRVSYPLCFIFCSPVGCKPEQQMMYAGSKNRLVQSAELTKIFEVRNPDDLTEDWLKQ 136

  Fly   136 KL 137
            ||
Zfish   137 KL 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 59/121 (49%)
gmfgNP_001035136.1 ADF_GMF-beta_like 9..130 CDD:200439 59/121 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1477747at2759
OrthoFinder 1 1.000 FOG0001768
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.