DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GMF and Gmfg

Sequence 1:NP_609787.2 Gene:GMF FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001034281.1 Gene:Gmfg MGIID:1927135 Length:142 Species:Mus musculus

Alignment Length:138 Identity:73/139 (53%)
Similarity:104/139 (75%) Gaps:1/139 (1%)


  Fly     1 MSDN-QICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQ 64
            |||: .:|::..|:.|.|:||||.|..||||:|:|||:::|.|||::.:.:||.:||:..||..|
Mouse     1 MSDSLVVCEVDPELKETLRKFRFRKETNNAAIIMKVDKDRQMVVLEDELQNISPEELKLELPERQ 65

  Fly    65 PRYVIYTYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELT 129
            ||:|:|:||.||||.|:|||:||||.:|...:.|.|||||.:|:.|.:..:||:|:|||..|:||
Mouse    66 PRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLT 130

  Fly   130 EEWLKAKL 137
            |.|||.||
Mouse   131 ETWLKEKL 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 62/121 (51%)
GmfgNP_001034281.1 ADF_GMF-beta_like 9..130 CDD:200439 62/121 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C135362149
eggNOG 1 0.900 E1_KOG1736
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 155 1.000 Inparanoid score I4266
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001768
OrthoInspector 1 1.000 T616650
orthoMCL 1 0.900 OOG5_130100
Panther 1 1.100 O PTHR11249
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1785
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.