DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GMF and Gmfb

DIOPT Version :8

Sequence 1:NP_609787.2 Gene:GMF / 34963 FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_071306.2 Gene:Gmfb / 63985 MGIID:1927133 Length:142 Species:Mus musculus

Alignment Length:132 Identity:67/133 (50%)
Similarity:104/133 (78%) Gaps:0/133 (0%)


  Fly     6 ICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQPRYVIY 70
            :||::.:::|:|:||||.|..:|||:|:|:|::::.|||||.::.:|.|||:|.||..|||:::|
Mouse     7 VCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVY 71

  Fly    71 TYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELTEEWLKA 135
            :||..|||.|:|||:||||.:|...:.|.|||||.:|:.|.:..:||:|:|||..::||||||:.
Mouse    72 SYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLRE 136

  Fly   136 KL 137
            ||
Mouse   137 KL 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 59/121 (49%)
GmfbNP_071306.2 ADF_GMF-beta_like 9..130 CDD:200439 59/121 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C135362812
eggNOG 1 0.900 E1_KOG1736
Hieranoid 1 1.000
Homologene 1 1.000 H37882
Inparanoid 1 1.050 155 1.000 Inparanoid score I4266
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1477747at2759
OrthoFinder 1 1.000 FOG0001768
OrthoInspector 1 1.000 T616650
orthoMCL 1 0.900 OOG5_130100
Panther 1 1.100 LDO PTHR11249
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1785
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.