DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GMF and gmfg

Sequence 1:NP_609787.2 Gene:GMF FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001025651.1 Gene:gmfg XenbaseID:XB-GENE-947192 Length:142 Species:Xenopus tropicalis

Alignment Length:138 Identity:74/139 (53%)
Similarity:105/139 (76%) Gaps:1/139 (1%)


  Fly     1 MSDN-QICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQ 64
            |||: .:||:..|:.|:|:||||.|..||||:::|:|:|||.|:|:|...|||.||||:.||..|
 Frog     1 MSDSLVVCDVDPELKEKLRKFRFRKETNNAAILMKIDKEKQLVILEEEYQDISPDELQNELPERQ 65

  Fly    65 PRYVIYTYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELT 129
            ||:::|:||.||:|.|||||:||||.:|...:.|.|||||.:|:.|.:..:||:|:|||...:||
 Frog    66 PRFLVYSYKYVHEDGRISYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRNTSDLT 130

  Fly   130 EEWLKAKL 137
            |:|||.:|
 Frog   131 EDWLKERL 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 64/121 (53%)
gmfgNP_001025651.1 ADF_GMF-beta_like 9..130 CDD:200439 64/121 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C135359105
eggNOG 1 0.900 E1_KOG1736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1477747at2759
OrthoFinder 1 1.000 FOG0001768
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.