DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GMF and gmfb

Sequence 1:NP_609787.2 Gene:GMF FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_001017002.1 Gene:gmfb XenbaseID:XB-GENE-6077246 Length:142 Species:Xenopus tropicalis

Alignment Length:132 Identity:70/133 (53%)
Similarity:101/133 (76%) Gaps:0/133 (0%)


  Fly     6 ICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQPRYVIY 70
            :||:..|::|:||||||.|..||||:|:|:|::::.|||:|..:.||.|||:|.||..|||:::|
 Frog     7 VCDVDAELVEKLKKFRFRKETNNAAIIMKIDKDRRLVVLEEEHEGISPDELKDELPERQPRFIVY 71

  Fly    71 TYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELTEEWLKA 135
            :||..|||.|:|||:||||.:|...:.|.|||||.:|:.|.:..:||:|:|||..::||||||..
 Frog    72 SYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLTE 136

  Fly   136 KL 137
            ||
 Frog   137 KL 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 62/121 (51%)
gmfbNP_001017002.1 ADF_GMF-beta_like 9..130 CDD:200439 62/121 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C135359276
eggNOG 1 0.900 E1_KOG1736
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H37882
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1477747at2759
OrthoFinder 1 1.000 FOG0001768
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.