DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GMF and Y50D7A.10

Sequence 1:NP_609787.2 Gene:GMF FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_871652.2 Gene:Y50D7A.10 WormBaseID:WBGene00021758 Length:138 Species:Caenorhabditis elegans

Alignment Length:131 Identity:57/132 (43%)
Similarity:90/132 (68%) Gaps:0/132 (0%)


  Fly     6 ICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQPRYVIY 70
            ||.|.:.|.|:|||||||||....|||||:|||...:..::.::|.|::|.::.||..|||:::.
 Worm     7 ICSIPDGVKEDLKKFRFSKSTTMNALILKIDRESHELQSEQLLNDCSIEEFKEELPSQQPRFILL 71

  Fly    71 TYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELTEEWLKA 135
            ::...|.|:||||||..|:|.|..|..||||:||.:::.:..|..:::..|||::||:.:|.|::
 Worm    72 SWCKKHSDERISYPMLLIYYCPNGSSPELQMLYAGSRNFIVNECHVSKNTEIRDIDEIDDELLES 136

  Fly   136 K 136
            |
 Worm   137 K 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 52/121 (43%)
Y50D7A.10NP_871652.2 ADF_GMF-beta_like 9..130 CDD:200439 52/121 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C135354866
eggNOG 1 0.900 E1_KOG1736
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I3288
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1477747at2759
OrthoFinder 1 1.000 FOG0001768
OrthoInspector 1 1.000 T477517
orthoMCL 1 0.900 OOG5_130100
Panther 1 1.100 LDO PTHR11249
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1785
TreeFam 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.