DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GMF and Y50D7A.10

DIOPT Version :9

Sequence 1:NP_609787.2 Gene:GMF / 34963 FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_871652.2 Gene:Y50D7A.10 / 259487 WormBaseID:WBGene00021758 Length:138 Species:Caenorhabditis elegans


Alignment Length:131 Identity:57/131 - (43%)
Similarity:90/131 - (68%) Gaps:0/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQPRYVIY 70
            ||.|.:.|.|:|||||||||....|||||:|||...:..::.::|.|::|.::.||..|||:::.
 Worm     7 ICSIPDGVKEDLKKFRFSKSTTMNALILKIDRESHELQSEQLLNDCSIEEFKEELPSQQPRFILL 71

  Fly    71 TYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELTEEWLKA 135
            ::...|.|:||||||..|:|.|..|..||||:||.:::.:..|..:::..|||::||:.:|.|::
 Worm    72 SWCKKHSDERISYPMLLIYYCPNGSSPELQMLYAGSRNFIVNECHVSKNTEIRDIDEIDDELLES 136

  Fly   136 K 136
            |
 Worm   137 K 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 52/120 (43%)
Y50D7A.10NP_871652.2 ADF_GMF-beta_like 9..130 CDD:200439 52/120 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165656
Domainoid 1 1.000 116 1.000 Domainoid score I3759
eggNOG 1 0.900 - - E1_KOG1736
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 122 1.000 Inparanoid score I3324
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54482
OrthoDB 1 1.010 - - D1477747at2759
OrthoFinder 1 1.000 - - FOG0002926
OrthoInspector 1 1.000 - - oto19861
orthoMCL 1 0.900 - - OOG6_104464
Panther 1 1.100 - - LDO PTHR11249
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1785
SonicParanoid 1 1.000 - - X2749
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.