DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GMF and gmf1

Sequence 1:NP_609787.2 Gene:GMF FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_593581.1 Gene:gmf1 PomBaseID:SPAC17H9.11 Length:141 Species:Schizosaccharomyces pombe

Alignment Length:132 Identity:41/133 (31%)
Similarity:75/133 (56%) Gaps:2/133 (2%)


  Fly     2 SDNQICDISNEVLEELKKFRFSKSKN-NAALILKVDREKQTVVLD-EFIDDISVDELQDTLPGHQ 64
            |:.::..||:..::|:.:||....|: ..|.|||||:..:.:|.| |.:|..|::|:.|.|....
pombe     3 SEARMFTISDTTMKEIDRFRLRLKKSVMYAFILKVDKATKEIVPDGEIMDLQSIEEVADELSETN 67

  Fly    65 PRYVIYTYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELT 129
            ||:::.:|.....|.|:|.|:..|::.|..:..:|.|:||..|...|....:.:|:|.|:.:::|
pombe    68 PRFILVSYPTKTTDGRLSTPLFMIYWRPSATPNDLSMIYASAKVWFQDVSQVHKVFEARDSEDIT 132

  Fly   130 EE 131
            .|
pombe   133 SE 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 38/123 (31%)
gmf1NP_593581.1 ADF_GMF-beta_like 9..132 CDD:200439 38/123 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I1889
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001768
OrthoInspector 1 1.000 T1125364
orthoMCL 1 0.900 OOG5_130100
Panther 1 1.100 LDO PTHR11249
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1785
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.