DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GMF and Gmfg

Sequence 1:NP_609787.2 Gene:GMF FlyBaseID:FBgn0028894 Length:138 Species:Drosophila melanogaster
Sequence 2:NP_851605.1 Gene:Gmfg RGDID:620506 Length:142 Species:Rattus norvegicus

Alignment Length:138 Identity:72/139 (52%)
Similarity:102/139 (73%) Gaps:1/139 (1%)


  Fly     1 MSDN-QICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQ 64
            |||: .:||:..|:.|.|:||||.|..||||:|:|||:::|.|||::...::|.:||:..||..|
  Rat     1 MSDSLVVCDVDPELKETLRKFRFRKETNNAAIIMKVDKDRQMVVLEDEFQNVSPEELKLELPERQ 65

  Fly    65 PRYVIYTYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELT 129
            ||:|:|:||.||||.|:|||:||||.:|...:.|.|||||.:|:.|.:..:||:|:|||..|:|.
  Rat    66 PRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQIAELTKVFEIRTTDDLN 130

  Fly   130 EEWLKAKL 137
            |.|||.||
  Rat   131 ETWLKEKL 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GMFNP_609787.2 ADF_GMF-beta_like 8..129 CDD:200439 62/121 (51%)
GmfgNP_851605.1 ADF_GMF-beta_like 9..129 CDD:200439 61/120 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C135360012
eggNOG 1 0.900 E1_KOG1736
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4127
OMA 1 1.010
OrthoDB 1 1.010 D1477747at2759
OrthoFinder 1 1.000 FOG0001768
OrthoInspector 1 1.000 T618771
orthoMCL 1 0.900 OOG5_130100
Panther 1 1.100 O PTHR11249
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.