DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pkaap and Akap10

DIOPT Version :8

Sequence 1:NP_609783.1 Gene:pkaap / 34957 FlyBaseID:FBgn0040079 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_064305.2 Gene:Akap10 / 56697 MGIID:1890218 Length:662 Species:Mus musculus

Alignment Length:577 Identity:155/578 (27%)
Similarity:259/578 (45%) Gaps:124/578 (21%)


  Fly   107 SRLSMNLASIVNDPNCLSYFVQYLDTRQALPLIKFYLDIENF----------------KRAALTQ 155
            |.||..|..::.|...|.||:|:::.|:...|:||:|:.|:|                |:::|.:
Mouse   120 SSLSKTLEQVLRDTVVLPYFLQFMELRRMEHLVKFWLEAESFHSTTWSRIRAHSLNTVKQSSLAE 184

  Fly   156 --EKEEPEEPPRKAIEQSSPHK--DDKDVPELKTL---CDLSMRKPLTDDEKSRIY----AETNK 209
              ...:..|.|..::.::...:  |....|.|.|.   .|||.|   |.:.::.:.    ..:.:
Mouse   185 PVSPSKRHETPASSVTEALDRRLGDSSSAPLLVTQSEGTDLSSR---TQNPQNHLLLSQEGHSAR 246

  Fly   210 QLNRQ--KSG-----TDS--------------------VLNAELSRASISDAIAIYQKYLIVNAS 247
            .|:|:  ::|     |||                    .|:.:|.::...||:..:.||:..:|:
Mouse   247 SLHREVARTGSHQIPTDSQDSSSRLAVGSRNSCSSPLRELSEKLMKSIEQDAVNTFTKYISPDAA 311

  Fly   248 LQVELPIVILAHISLLLCGRDKSECSKPIPASCFDEAREFVLEQLERDHVQGFLQSGYYSTYCLE 312
            ..:.:...:...|...:||.|..     :..:||..|:..|...:|::|...||:|.::..|.:|
Mouse   312 KPIPITEAMRNDIIAKICGEDGQ-----VDPNCFVLAQAVVFSAMEQEHFSEFLRSHHFCKYQIE 371

  Fly   313 LIEGGSVNIYDVLNSELALFYFTEYLEQRQERECLEFWITAINFRKSFACGEEKEEDRKAAQSDA 377
            ::..|:|.:.|:|..|.|||||:||:|:......|:||:.|.||:...| .::.:.|.:.||:||
Mouse   372 VLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLA-AKKGQYDGQEAQNDA 435

  Fly   378 MIIYDKYFSLQSECRLWMSQKLRLRVEQAIC-----APNEQWQAFDLALLVTAKYLEQKYFADFL 437
            ||:||||||||:...|.....:||.:|..||     .||    .|...|......:|:.:...||
Mouse   436 MILYDKYFSLQATHPLGFDDVVRLEIESNICREGGPLPN----CFTTPLRQAWTTMEKVFLPGFL 496

  Fly   438 KSHIFDNYVNEL--KVKRD------------NSTTHPNLQHTLSLRRAGKSSNGQQQRHRKTLSM 488
            .|:::..|:|:|  .|:.|            .|...|...|      :|.|.....|...|..|:
Mouse   497 SSNLYYKYLNDLIHSVRGDEFLGGNVSLAAHGSVCLPEESH------SGGSDGSTAQSSVKKASI 555

  Fly   489 SDCTHISQHNTLLASMDQAPSKTALNHQSGNLNIDARQLTNPQLLWQRP-VGALKFGFVNSLGRY 552
            .          :|.:.|:|            :.:||..| :|:.|:||. .|.:.||.|:.||::
Mouse   556 K----------ILKNFDEA------------IIVDAASL-DPESLYQRTYAGKMSFGRVSDLGQF 597

  Fly   553 ERDFEAVDAVALKSQPWSLSVSGSKLKNAMRKLVNLPEDNVQEEIAWQVAEMIVRDV 609
            .|:.|        .:|......|.....||:|.|....|..|||:||::|:|||.||
Mouse   598 IRESE--------PEPDVKKSKGFMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDV 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pkaapNP_609783.1 RGS 109..308 CDD:295367 54/253 (21%)
RGS_AKAP2_2 324..444 CDD:188676 46/125 (37%)
AKAP10_AKB 561..605 CDD:214003 14/44 (32%)
Akap10NP_064305.2 RGS_AKAP2_1 122..367 CDD:188689 54/253 (21%)
RGS_AKAP2_2 383..503 CDD:188676 46/125 (37%)
AKAP10_AKB 618..662 CDD:214003 16/30 (53%)
PKA-RII subunit binding 634..647 8/14 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C190569315
eggNOG 1 0.900 E1_KOG3590
Hieranoid 1 1.000
Homologene 1 1.000 H32452
Inparanoid 1 1.050 170 1.000 Inparanoid score I4096
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005818
OrthoInspector 1 1.000 T1083639
orthoMCL 1 0.900 OOG5_134157
Panther 1 1.100 LDO PTHR13155
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3006
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.