DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twe and Cdc25c

DIOPT Version :10

Sequence 1:NP_476633.1 Gene:twe / 34954 FlyBaseID:FBgn0002673 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_033990.2 Gene:Cdc25c / 12532 MGIID:88350 Length:447 Species:Mus musculus


Alignment Length:98 Identity:25/98 - (25%)
Similarity:37/98 - (37%) Gaps:32/98 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LPAD--TMLILQQFLQEK-----ALKERSEEAGPESAGCFEENWQLSQFWYNEETKQKLAL---- 76
            ||.|  ...:.|:|.|:|     |::..||::..|..       |:    :||...|.:..    
Mouse   711 LPPDHPVRRLFQRFRQQKEARLAAVRPNSEDSDLEKG-------QI----HNEVISQDVIATTSI 764

  Fly    77 ----------IVKHLQENNPSDTFQVALLSAPS 99
                      |..||.:|.....|..|.||||:
Mouse   765 VTVTESPATPIPSHLIKNRTLGPFDQAKLSAPA 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tweNP_476633.1 Cdc25 243..363 CDD:238788
Cdc25cNP_033990.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..109
Cdc25 275..394 CDD:238788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.