DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twe and Cdc25b

DIOPT Version :10

Sequence 1:NP_476633.1 Gene:twe / 34954 FlyBaseID:FBgn0002673 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_075606.1 Gene:Cdc25b / 12531 MGIID:99701 Length:576 Species:Mus musculus


Alignment Length:122 Identity:26/122 - (21%)
Similarity:42/122 - (34%) Gaps:34/122 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ESAGCFEENWQLSQFWYNEETK-------QKLALIVKHLQE-----NNPSDTFQVALLSAPSAFK 102
            :|.|||.:..:|    :|...|       ...|.|...|.|     .||      .:....|..:
Mouse   731 DSDGCFIQQGRL----FNSRMKGGVNDKVTMTAYITASLLELETPVTNP------VVTKGLSCLR 785

  Fly   103 HVVKENKNAMLFEFDERFASYGENFQQYDYNRAFDAGYMDAYAHQF-NLVIADPPFL 158
            .|:::.||           :|......|.::.|.|........::. ||.|:|.|.:
Mouse   786 FVIEDVKN-----------TYTTALLAYTFSLARDTNTRQQLFNKLENLAISDGPLV 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tweNP_476633.1 Cdc25 243..363 CDD:238788
Cdc25bNP_075606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..119
M-inducer_phosp 111..379 CDD:461962
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..358
Cdc25 408..527 CDD:238788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.