DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twe and Cdc25a

DIOPT Version :10

Sequence 1:NP_476633.1 Gene:twe / 34954 FlyBaseID:FBgn0002673 Length:426 Species:Drosophila melanogaster
Sequence 2:NP_001397314.1 Gene:Cdc25a / 12530 MGIID:103198 Length:522 Species:Mus musculus


Alignment Length:125 Identity:23/125 - (18%)
Similarity:41/125 - (32%) Gaps:26/125 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LQEKALKERSEEAGPESAGCFEENWQL-----------------SQFWYNEETKQKLALIV---- 78
            ||:.|.:|......|.....|...|.|                 |.|:...|...::||.:    
Mouse   197 LQKVANREAGGSYEPPLTNVFTMQWFLTMFATCLPHHTVLKIWDSVFFEGSEMLLRVALAIWAKL 261

  Fly    79 -KHLQENNPSDTF-QVALLSAPSAFKHVVKENKNAMLFEFDER---FASYGENFQQYDYN 133
             :.::|...:|.| .:.........:|.:.::...|...:...   |....|..::|.||
Mouse   262 GERIEECQTADEFYSIMGCLTQEMLEHKLIDSNELMQTVYSMAPFPFPQLAELREKYTYN 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tweNP_476633.1 Cdc25 243..363 CDD:238788
Cdc25aNP_001397314.1 Phosphodegron 73..83
M-inducer_phosp 85..326 CDD:461962 23/125 (18%)
KEN box 140..142
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..316 7/51 (14%)
Cdc25 355..472 CDD:238788
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.