DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and ESAM

DIOPT Version :10

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_620411.2 Gene:ESAM / 90952 HGNCID:17474 Length:390 Species:Homo sapiens


Alignment Length:191 Identity:46/191 - (24%)
Similarity:74/191 - (38%) Gaps:39/191 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTTILLALTLEMTA----ALRDVRVRVP----HAVRRSEKAILKCFYDIEDDSLYSVKWYKGRRE 68
            :|.:|..|.|.::|    :...:::.:|    .||...| .:|..:|.:..:...|..|     |
Human     9 VTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGE-VVLPAWYTLHGEVSSSQPW-----E 67

  Fly    69 ------FYRYTPKETPPMKVFH-----FPGVK-VRRVSSNESQVVLDAVTMATSGKYSCEVSAD- 120
                  |::...||...:...:     .|||. |..:.|....:.|:.:....||.|||.|:.. 
Human    68 VPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQD 132

  Fly   121 ------APSFHTLIAAAELEVIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTW 175
                  ..|..||    ||.|:..|  ||....::....||..:..:|.|..|:||....|
Human   133 KQGKSRGHSIKTL----ELNVLVPP--APPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQW 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 42..118 CDD:472250 20/87 (23%)
Ig strand B 44..48 CDD:409353 1/3 (33%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 3/4 (75%)
Ig 143..240 CDD:472250 9/33 (27%)
Ig strand B 158..162 CDD:409353 0/3 (0%)
Ig strand C 172..176 CDD:409353 1/4 (25%)
Ig strand E 205..209 CDD:409353
Ig strand F 222..227 CDD:409353
Ig strand G 235..238 CDD:409353
ESAMNP_620411.2 V-set 40..150 CDD:462230 28/119 (24%)
Ig strand B 154..158 CDD:409353 2/3 (67%)
IG_like 166..241 CDD:214653 8/22 (36%)
Ig strand E 194..198 CDD:409353
Ig strand F 221..226 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.