DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and jam2

DIOPT Version :10

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001072218.1 Gene:jam2 / 779665 XenbaseID:XB-GENE-493973 Length:295 Species:Xenopus tropicalis


Alignment Length:156 Identity:42/156 - (26%)
Similarity:62/156 - (39%) Gaps:21/156 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VRRSEKAILKCFYDIEDDSLYSVKWYK----GRREFYRYTPKETPPMKVFHFPGVKVRRVSSNES 98
            |:...:.||.|.|.:|.:....::|.|    |...|..|.......::         .|....||
 Frog    35 VQEFGEIILSCKYKLEKEHPVRLEWKKVVPNGDISFIYYNNTLAADLR---------GRAEMIES 90

  Fly    99 QVVLDAVTMATSGKYSCEVSA--DAPSFHTLIAAAELEVIETPHNAPFITGIRPRYRVGDILRGN 161
            .:.|...|.|.||||.|||:|  |..||..::  .:|:|:..| ..| :..:.|....|..:...
 Frog    91 SIWLKNATRADSGKYRCEVTAPKDNKSFQEIV--IDLKVLVAP-GVP-VCDVPPSAMSGTAVELK 151

  Fly   162 CTSRHSRPAANLTWTVNN--EEVNPA 185
            |......||:...|..|.  ..:|||
 Frog   152 CRESEGFPASEYRWYKNGILLAINPA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 42..118 CDD:472250 22/79 (28%)
Ig strand B 44..48 CDD:409353 2/3 (67%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..117 CDD:409353 3/4 (75%)
Ig 143..240 CDD:472250 11/45 (24%)
Ig strand B 158..162 CDD:409353 0/3 (0%)
Ig strand C 172..176 CDD:409353 0/3 (0%)
Ig strand E 205..209 CDD:409353
Ig strand F 222..227 CDD:409353
Ig strand G 235..238 CDD:409353
jam2NP_001072218.1 Ig 26..128 CDD:472250 29/103 (28%)
Ig strand B 41..45 CDD:409353 2/3 (67%)
Ig strand C 56..60 CDD:409353 0/3 (0%)
Ig strand E 90..94 CDD:409353 1/3 (33%)
Ig strand F 104..109 CDD:409353 3/4 (75%)
Ig strand G 120..123 CDD:409353 0/4 (0%)
Ig 134..230 CDD:472250 11/45 (24%)
Ig strand B 148..152 CDD:409353 0/3 (0%)
Ig strand C 162..166 CDD:409353 0/3 (0%)
Ig strand E 194..198 CDD:409353
Ig strand F 208..213 CDD:409353
Ig strand G 223..226 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.