DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and Esam

DIOPT Version :10

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_081378.1 Gene:Esam / 69524 MGIID:1916774 Length:394 Species:Mus musculus


Alignment Length:203 Identity:51/203 - (25%)
Similarity:78/203 - (38%) Gaps:41/203 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QTALTTILLALTLEMTAAL--RDVRVRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYR 71
            :|:|..:|. |.|...||.  ..:.:.||..:.:.|.        :|.:.:....||...||...
Mouse     9 ETSLLRVLF-LGLSTLAAFSRAQMELHVPPGLNKLEA--------VEGEEVVLPAWYTMAREESW 64

  Fly    72 YTPKETP------------PMKVFHF--------PGVK-VRRVSSNESQVVLDAVTMATSGKYSC 115
            ..|:|.|            |.:|..:        ||.. |..:||....:.|.|:....||.|.|
Mouse    65 SHPREVPILIWFLEQEGKEPNQVLSYINGVMTNKPGTALVHSISSRNVSLRLGALQEGDSGTYRC 129

  Fly   116 EVSA---DAPSFHTLIAAAELEVIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTV 177
            .|:.   :..|....|.:.||:|:..|  ||....::....||..:..||.|..|:|.|...|  
Mouse   130 SVNVQNDEGKSIGHSIKSIELKVLVPP--APPSCSLQGVPYVGTNVTLNCKSPRSKPTAQYQW-- 190

  Fly   178 NNEEVNPA 185
              |.:.|:
Mouse   191 --ERLAPS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 42..118 CDD:472250 22/96 (23%)
Ig strand B 44..48 CDD:409353 0/3 (0%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig 143..240 CDD:472250 12/43 (28%)
Ig strand B 158..162 CDD:409353 0/3 (0%)
Ig strand C 172..176 CDD:409353 0/3 (0%)
Ig strand E 205..209 CDD:409353
Ig strand F 222..227 CDD:409353
Ig strand G 235..238 CDD:409353
EsamNP_081378.1 V-set 42..153 CDD:462230 27/118 (23%)
IG_like 169..244 CDD:214653 11/32 (34%)
Ig strand B 173..177 CDD:409353 0/3 (0%)
Ig strand C 187..191 CDD:409353 1/7 (14%)
Ig strand E 210..214 CDD:409353
Ig strand F 224..229 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..372
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.