DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and CEACAM6

DIOPT Version :10

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_002474.4 Gene:CEACAM6 / 4680 HGNCID:1818 Length:344 Species:Homo sapiens


Alignment Length:87 Identity:23/87 - (26%)
Similarity:41/87 - (47%) Gaps:4/87 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 RVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELEVIETPHNAPFITGIRPRYRVGD 156
            ::|:....:.|.:|....:|.|.||:...|.:..:  ....|.|:..| :.|.|:..:..||.|:
Human   192 QLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRS--DPVTLNVL
YGP-DVPTISPSKANYRPGE 253

  Fly   157 ILRGNCTSRHSRPAANLTWTVN 178
            .|..:|.:. |.|.|..:|.:|
Human   254 NLNLSCHAA-SNPPAQYSWFIN 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 42..118 CDD:472250 7/25 (28%)
Ig strand B 44..48 CDD:409353
Ig strand C 59..63 CDD:409353
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig 143..240 CDD:472250 12/36 (33%)
Ig strand B 158..162 CDD:409353 1/3 (33%)
Ig strand C 172..176 CDD:409353 0/3 (0%)
Ig strand E 205..209 CDD:409353
Ig strand F 222..227 CDD:409353
Ig strand G 235..238 CDD:409353
CEACAM6NP_002474.4 IgV_CEACAM_D1 36..140 CDD:409430
FR1 37..55 CDD:409430
Ig strand A 37..39 CDD:409430
Ig strand A' 44..46 CDD:409430
Ig strand B 49..56 CDD:409430
CDR1 56..63 CDD:409430
FR2 64..69 CDD:409430
Ig strand C 64..68 CDD:409430
CDR2 70..91 CDD:409430
Ig strand C' 78..83 CDD:409430
Ig strand C' 88..91 CDD:409430
FR3 98..124 CDD:409430
Ig strand D 98..103 CDD:409430
Ig strand E 105..109 CDD:409430
Ig strand F 119..124 CDD:409430
CDR3 125..132 CDD:409430
FR4 133..140 CDD:409430
Ig strand G 133..139 CDD:409430
IgI_hCEACAM_2_4_6_like 146..234 CDD:409402 9/43 (21%)
Ig strand A 146..150 CDD:409402
Ig strand A' 153..158 CDD:409402
Ig strand B 163..169 CDD:409402
Ig strand C 176..181 CDD:409402
Ig strand C' 183..186 CDD:409402
Ig strand D 190..194 CDD:409402 0/1 (0%)
Ig strand E 197..202 CDD:409402 0/4 (0%)
Ig strand F 212..220 CDD:409402 3/7 (43%)
Ig strand G 224..233 CDD:409402 1/10 (10%)
IgC2_CEACAM5-like 243..318 CDD:409540 10/33 (30%)
Ig strand A 243..249 CDD:409540 0/5 (0%)
Ig strand B 254..261 CDD:409540 2/6 (33%)
Ig strand C 267..273 CDD:409540 2/5 (40%)
Ig strand C' 276..281 CDD:409540
Ig strand E 284..290 CDD:409540
Ig strand F 293..304 CDD:409540
Ig strand G 307..318 CDD:409540
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.