DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and beat-IV

DIOPT Version :8

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster

Alignment Length:199 Identity:70/200 (35%)
Similarity:115/200 (58%) Gaps:16/200 (8%)


  Fly    53 EDDSLYSVKWYKGRREFYRYTPKETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEV 117
            |.::||::||||...|||||.||..||...:...||:|....|:.|:|:|..:|:.::|.|.|||
  Fly   207 EGEALYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRVIEELSDASRVLLRGLTLNSTGLYRCEV 271

  Fly   118 SADAPSFHTLIAAAELEVIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEV 182
            ||:||:|.::.....::::..|.:.|.|.|.:.:|::|:.|..||||..|.||::|.|.||.:  
  Fly   272 SAEAPNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQ-- 334

  Fly   183 NPALVRH--HKILRDARND------METAVVGIHFVVTDQHFDNGKLKLRCSAQLHDVYWKTTEK 239
             |.|..|  ||.     ||      :.|:.:|:...:..:||..|.::::|.|.:..|.||..::
  Fly   335 -PILDEHYLHKY-----NDIVHKHGLITSTLGLQLPLEPRHFHEGDMRVKCLASISPVLWKGGKE 393

  Fly   240 IILE 243
            .:|:
  Fly   394 SVLQ 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 29/65 (45%)
Ig 161..240 CDD:299845 28/87 (32%)
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 32/73 (44%)
Ig 314..>362 CDD:299845 20/56 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21261
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.