DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and beat-IV

DIOPT Version :10

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster


Alignment Length:199 Identity:70/199 - (35%)
Similarity:115/199 - (57%) Gaps:16/199 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EDDSLYSVKWYKGRREFYRYTPKETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEV 117
            |.::||::||||...|||||.||..||...:...||:|....|:.|:|:|..:|:.::|.|.|||
  Fly   207 EGEALYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRVIEELSDASRVLLRGLTLNSTGLYRCEV 271

  Fly   118 SADAPSFHTLIAAAELEVIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEV 182
            ||:||:|.::.....::::..|.:.|.|.|.:.:|::|:.|..||||..|.||::|.|.||.:  
  Fly   272 SAEAPNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQ-- 334

  Fly   183 NPALVRH--HKILRDARND------METAVVGIHFVVTDQHFDNGKLKLRCSAQLHDVYWKTTEK 239
             |.|..|  ||.     ||      :.|:.:|:...:..:||..|.::::|.|.:..|.||..::
  Fly   335 -PILDEHYLHKY-----NDIVHKHGLITSTLGLQLPLEPRHFHEGDMRVKCLASISPVLWKGGKE 393

  Fly   240 IILE 243
            .:|:
  Fly   394 SVLQ 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 42..118 CDD:472250 28/64 (44%)
Ig strand B 44..48 CDD:409353
Ig strand C 59..63 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 2/3 (67%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig 143..240 CDD:472250 34/104 (33%)
Ig strand B 158..162 CDD:409353 1/3 (33%)
Ig strand C 172..176 CDD:409353 1/3 (33%)
Ig strand E 205..209 CDD:409353 1/3 (33%)
Ig strand F 222..227 CDD:409353 1/4 (25%)
Ig strand G 235..238 CDD:409353 1/2 (50%)
beat-IVNP_001262876.1 V-set <210..271 CDD:462230 26/60 (43%)
Ig 297..>362 CDD:472250 26/72 (36%)
Ig strand B 312..316 CDD:409353 1/3 (33%)
Ig strand C 326..330 CDD:409353 1/3 (33%)
Ig strand E 357..361 CDD:409353 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.