DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and beat-IIa

DIOPT Version :8

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001287375.1 Gene:beat-IIa / 42086 FlyBaseID:FBgn0038498 Length:431 Species:Drosophila melanogaster

Alignment Length:447 Identity:141/448 (31%)
Similarity:197/448 (44%) Gaps:102/448 (23%)


  Fly     3 FPQNAYQTALTTILLALTLEMTAALRDVRVRV-PHAVRRSEKAILKCFYDIEDDSLYSVKWYKGR 66
            ||.......|..:||::.| :..|||:|.:.: |.||||.:..:|:|.||::...|||.|:|:|:
  Fly    45 FPARCLLLLLGVLLLSMEL-VECALRNVNLIIEPPAVRRGQHVVLRCMYDLDGAPLYSAKFYRGQ 108

  Fly    67 REFYRYTPKETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAA 131
            .|||||||.|.|..|||.|||:.|...|||.:||:|..|....||.:||||:||||.|.|..|..
  Fly   109 LEFYRYTPGEFPNTKVFPFPGIHVDVSSSNATQVLLRNVGFGLSGNFSCEVTADAPLFSTATAVD 173

  Fly   132 ELEVIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNN---EEVNPALVRHHKIL 193
            .::|:|.|...|.:.....||..||:||.||::..|||.|.||:|:||   ..|:...:|....|
  Fly   174 TMQVVELPEKRPQVFTEHTRYEPGDVLRANCSTPPSRPRAELTFTINNMVITHVDTEYIRTIDNL 238

  Fly   194 RDARNDMETAVVGIHF-VVTDQHFDN---------------------GKLKLRCSAQLHDVY--W 234
            ...|..::..:.|||| .|....::|                     |.|.||||||:.|:|  :
  Fly   239 IATRISLKMQLQGIHFSSVNPAIYNNVYGLNSVYGHGGPVYAPNSNPGGLLLRCSAQIGDLYQEY 303

  Fly   235 KTTEKIILETDLFPKHGNGANGNHVNPDDFYDQYALHEDHLHNKKNSYLTQLQEFFFYHFVPSGE 299
            |..|....:.|..|.                 :..|..|          |.|:.||..:|..|  
  Fly   304 KEIELGTPQKDPVPA-----------------RVTLSSD----------TSLKNFFSSYFSTS-- 339

  Fly   300 EDDGTEGGLGDGGAAWRGAGSSSSRLSPSSSQSCWMVGGSLMAVLSWTLARQLVSPLQAMMTKTG 364
                               .|::|||.|          |..||.|...:...|...::|..    
  Fly   340 -------------------ASAASRLLP----------GVYMAPLIMAMLASLFRLIEAAF---- 371

  Fly   365 GATCNMSGRCASRRTRAHGMRVSATKQKQKQRQMQQEHRKSCLRVSKSS-----WKG 416
             ..|:.|.:....:| .|.|..|..:::.|:|....   .|| .|||:|     |.|
  Fly   372 -EPCDASSQDPQSQT-GHSMEHSKERREPKERPALV---SSC-SVSKASRQQLAWPG 422

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 44/87 (51%)
Ig 161..240 CDD:299845 33/106 (31%)
beat-IIaNP_001287375.1 PTZ00491 <209..>261 CDD:240439 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124149183
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21261
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.