DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and beat-IIb

DIOPT Version :8

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_650613.2 Gene:beat-IIb / 42082 FlyBaseID:FBgn0038494 Length:407 Species:Drosophila melanogaster

Alignment Length:356 Identity:109/357 (31%)
Similarity:162/357 (45%) Gaps:80/357 (22%)


  Fly    15 ILLALTLEM-TAALRDVRVRV-PHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRYTPKET 77
            :||.|..:. .||||||.:.| |.||||.:...|:|.|.:.:..|||:|:|:|:.|||||||.|.
  Fly    83 LLLCLFCDFGQAALRDVNLLVEPPAVRRGQSVALRCDYQLVEAPLYSIKFYRGQMEFYRYTPGEY 147

  Fly    78 PPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELEVIETPHNA 142
            ||.|||.|||::|....||.:.|::..|:...||::||||:||||.:.|..|.|:::|:|.|...
  Fly   148 PPTKVFQFPGIRVDENGSNATTVLIRNVSFGLSGQFSCEVTADAPLYSTATAFAQMQVVEFPEKR 212

  Fly   143 PFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEVNPALVRHHKILRD------ARNDME 201
            |.:.....||..||:||.||::..|||.|:|.:|:||..|:.......:.:|.      :|..::
  Fly   213 PQLFTEHSRYEPGDVLRANCSTLPSRPRADLRFTINNIPVSIPFTEETQYIRTVDSLIASRLSLK 277

  Fly   202 TAVVGIHFVVTDQHFDNGK-------------------------------LKLRCSAQLHDVY-- 233
            ..:...|||.......||.                               |.|||:||:.|:|  
  Fly   278 LQLQATHFVAGLSAHGNGNGNGNGNGNGNGNGLANALHLGGGGGGAGGGGLILRCTAQIGDLYQE 342

  Fly   234 WKTTEKIILETDLFPKHGNGANGNHVNPDDFYDQYALHEDHLHNKKNSYLTQLQEFFFYHFVPSG 298
            :|..|....:.|..|.....::|                           |.|:.|...:|..| 
  Fly   343 YKEIELGTPQKDPVPARVTLSSG---------------------------TGLRGFLETYFATS- 379

  Fly   299 EEDDGTEGGLGDGGAAWRGAGSSSSRLSPSS 329
                       .|.:.|||:....:...|::
  Fly   380 -----------SGPSNWRGSAGVVAIFLPTA 399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 42/87 (48%)
Ig 161..240 CDD:299845 28/118 (24%)
beat-IIbNP_650613.2 IG_like 108..198 CDD:214653 44/90 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124149182
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21261
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.