DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and beat-Vb

DIOPT Version :10

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_731748.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster


Alignment Length:253 Identity:73/253 - (28%)
Similarity:109/253 - (43%) Gaps:49/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLALTLEMTAALRDVR------VRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRYTP 74
            ||.|.:.|...:|.::      :.||..|...:...|.|.|||...:|.||||||..:||:||:|
  Fly     7 LLQLGVHMLLVVRRIQCLRVTDINVPQIVDFRDNVTLSCSYDISGHTLNSVKWYKNGKEFFRYSP 71

  Fly    75 KETPPMKV-FHFPGVKV----RRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELE 134
            . |||..: |...||::    ...:.:..:|.|:.:.:.:||.|.||||.|||.|......|.:.
  Fly    72 L-TPPTYIPFAVEGVQLIDDGNECNESSCRVELNLLGVKSSGVYRCEVSGDAPHFQLTARDANMT 135

  Fly   135 VIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEVNPALVRHHKILRDARND 199
            |...|.|.|.|:.....||..|.:..||::..|.....:||.||..:|:         |.|....
  Fly   136 VEALPQNNPLISSFHSTYRFNDFVEVNCSTDFSSLFTRITWYVNGIKVS---------LVDLLPS 191

  Fly   200 METAVVG-----------IHFVVTDQHFDNGK-----------------LKLRCSAQL 229
            .||.:|.           ::|...:..|...:                 |:|||.|::
  Fly   192 FETTIVAHGYSMRRIVSQLNFYANEPRFHQLQLQKLIQQKRTISPARLGLELRCVAEI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 42..118 CDD:472250 30/80 (38%)
Ig strand B 44..48 CDD:409353 1/3 (33%)
Ig strand C 59..63 CDD:409353 3/3 (100%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig 143..240 CDD:472250 25/115 (22%)
Ig strand B 158..162 CDD:409353 0/3 (0%)
Ig strand C 172..176 CDD:409353 1/3 (33%)
Ig strand E 205..209 CDD:409353 1/14 (7%)
Ig strand F 222..227 CDD:409353 3/4 (75%)
Ig strand G 235..238 CDD:409353
beat-VbNP_731748.1 Ig 24..129 CDD:472250 39/105 (37%)
Ig strand B 41..45 CDD:409353 1/3 (33%)
Ig strand C 56..60 CDD:409353 3/3 (100%)
Ig strand E 91..103 CDD:409353 1/11 (9%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig strand G 126..129 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.