DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and beat-Va

DIOPT Version :8

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001189214.1 Gene:beat-Va / 41578 FlyBaseID:FBgn0038087 Length:300 Species:Drosophila melanogaster

Alignment Length:271 Identity:81/272 (30%)
Similarity:120/272 (44%) Gaps:31/272 (11%)


  Fly    12 LTTILLALTLE--MTAALRDVRVRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRYTP 74
            |..:.:||.::  :..||....:.||..|...:...|.|.||:...:|.||||||...||:||:|
  Fly     6 LMFLFIALLIDYPIAYALFVTDISVPEIVDFRDNVTLSCSYDMRGHTLNSVKWYKDHEEFFRYSP 70

  Fly    75 KETPPMKVFHFPGVKV--RRVSSNESQVVLDAVTMA--TSGKYSCEVSADAPSFHTLIAAAELEV 135
            ..:|....|...|::|  .:...|||...||.....  ::|.|.||||.|||.|.....|..:.|
  Fly    71 LTSPIYMTFDVAGLQVLEGKYVCNESSCRLDLSLQGAKSTGLYKCEVSGDAPHFKLADKADNMTV 135

  Fly   136 IETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEE---------VNPALVRHHK 191
            ...|.|.|.|......||:.:.|:..|.|..|.....|||.:|.|:         .:.:|..|..
  Fly   136 AALPQNDPLIESFNSMYRMEEYLKATCISDFSSLPTRLTWYINGEQPLLGELYPTTDTSLAAHDY 200

  Fly   192 ILRDARNDMETAVVGIHFVVTDQHFDNGK-LKLRCSAQLHDV----YWKTTEKIILETDLFP--- 248
            :||..|..::..:.|..|      |..|| |:|:|.|::.:.    ..||....:.:.|.|.   
  Fly   201 VLRRQRLQVQFFLQGQRF------FQAGKILELKCVAEIENYPELRREKTLSASLSQYDNFNNQM 259

  Fly   249 --KHGNGANGN 257
              :|.|..:|:
  Fly   260 PLRHANANSGS 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 33/90 (37%)
Ig 161..240 CDD:299845 24/93 (26%)
beat-VaNP_001189214.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124149140
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5410
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21261
RoundUp 00.000 Not matched by this tool.
44.080

Return to query results.
Submit another query.