DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and CG5597

DIOPT Version :10

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_611841.1 Gene:CG5597 / 37789 FlyBaseID:FBgn0034920 Length:260 Species:Drosophila melanogaster


Alignment Length:159 Identity:41/159 - (25%)
Similarity:65/159 - (40%) Gaps:37/159 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EKAILKCFYDIEDDSLY-SVKWYKGRREFYRYTPKETPPMKVFHFPG-VKVRRVSSNE-----SQ 99
            |..||.|.|::|:...: :||||:..:..|::. ..|||..:..|.. :.....||.|     |.
  Fly    40 EPTILDCDYEVEESPKFITVKWYRDDKSIYQWI-FGTPPYAIPEFRNEIDSTYESSTEPSKQYSS 103

  Fly   100 VVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELEVIE-----------TPHNAPFITGIRPRYR 153
            :.|...|:||:|.|.|.|..   |.:|..:...::||:           |.||...:        
  Fly   104 LALINPTIATTGDYKCVVQT---SLNTFSSHQRVQVIDLRNYTLELSHKTIHNETQL-------- 157

  Fly   154 VGDILRGNCTSRHSRPAANLTWTVNNEEV 182
                   |||..:..|...:|...|:.:|
  Fly   158 -------NCTVTNVYPRPTITIISNDMDV 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 42..118 CDD:472250 26/82 (32%)
Ig strand B 44..48 CDD:409353 2/3 (67%)
Ig strand C 59..63 CDD:409353 2/3 (67%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig 143..240 CDD:472250 7/40 (18%)
Ig strand B 158..162 CDD:409353 0/3 (0%)
Ig strand C 172..176 CDD:409353 1/3 (33%)
Ig strand E 205..209 CDD:409353
Ig strand F 222..227 CDD:409353
Ig strand G 235..238 CDD:409353
CG5597NP_611841.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.