DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and beat-IIIb

DIOPT Version :8

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster

Alignment Length:399 Identity:131/400 (33%)
Similarity:205/400 (51%) Gaps:44/400 (11%)


  Fly    11 ALTTILLALTLEMTAALRDVRVRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRYTPK 75
            ||..:||.|..|....|....:::|..:.|.|.|:|.|.:|::.:|||||||||...|||||.|:
  Fly    15 ALFILLLQLCFESVECLTMTEIKIPKHIMRHEDAVLGCKFDLDGESLYSVKWYKDGFEFYRYVPR 79

  Fly    76 ETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELEVIETPH 140
            :.||.:||..|||.|...:|.:..|||.:|::.::|:|.||||.:||||.|:....::.|:.||.
  Fly    80 DMPPGQVFPLPGVDVELQNSTDVVVVLRSVSLQSTGRYRCEVSGEAPSFQTVSGHEDMIVVVTPK 144

  Fly   141 NAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEVNPALVRHHKILRDARNDMETAVV 205
            :.|.|||.:|||::||::|.||||..|||..:|:|.:|....|.:|:|.::.|...|..:|.|.:
  Fly   145 HGPQITGGQPRYQIGDMVRVNCTSAASRPVCHLSWLINGMHANRSLLRPYEPLIVGREGLEVARL 209

  Fly   206 GIHFVVTDQHFDNGKLKLRCSAQLHDVYWKTTEKIILETDLFPKHGNGANGNHVNPDDFYDQYAL 270
            |:.|.|...||.:|.:||:|.|::..|||::.|:.: |:|   ||................:.::
  Fly   210 GLEFRVRGXHFKHGDMKLKCVAKISSVYWQSNEESV-ESD---KHQRIPVLESRETVMSKSRQSM 270

  Fly   271 HEDHLHNKKNSYLTQLQEFFFYHFVPSGEEDDGTEGGLGDGGAAWRGAGSSSSRLSPSSSQSCWM 335
            .:..|.:|      ||::        |......|........||   |.||:||.:.:...:.| 
  Fly   271 DKAQLEDK------QLKK--------SRRPAAATSAAAAAAAAA---ASSSASRATVAPFGAMW- 317

  Fly   336 VGGSL---MAVLSWTLAR-------QLVSPLQAMMTKTG-GATCNMSGRCASRRTRAHGMRVSAT 389
             |.|:   ..:.|.::||       .|::.|.:.....| |.:|.          |::|.|.|:|
  Fly   318 -GSSVPWSRILASKSIARISLYALPVLIAFLCSFRPAVGQGCSCR----------RSNGSRGSST 371

  Fly   390 KQKQKQRQM 398
            ........|
  Fly   372 SSNINSSNM 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 40/86 (47%)
Ig 161..240 CDD:299845 31/79 (39%)
beat-IIIbNP_788071.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C124149006
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5410
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001856
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21261
RoundUp 00.000 Not matched by this tool.
44.080

Return to query results.
Submit another query.