DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and CADM2

DIOPT Version :9

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:XP_016861551.1 Gene:CADM2 / 253559 HGNCID:29849 Length:449 Species:Homo sapiens


Alignment Length:223 Identity:50/223 - (22%)
Similarity:97/223 - (43%) Gaps:36/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AILKCFYDIEDDSLYSVKWYKGRREFYRYTPKETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMA 108
            |||.|..|..|::  |::|....::...:..|     |......:::.|.|.:|..:.:..|:::
Human    54 AILTCRVDQNDNT--SLQWSNPAQQTLYFDDK-----KALRDNRIELVRASWHELSISVSDVSLS 111

  Fly   109 TSGKYSCEVSADAPSFHTL---IAAAELEVIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPA 170
            ..|:|:|       |..|:   .:.|.|.|:..|.. |.|:|.......||:::..|.:..|:||
Human   112 DEGQYTC-------SLFTMPVKTSKAYLTVLGVPEK-PQISGFSSPVMEGDLMQLTCKTSGSKPA 168

  Fly   171 ANLTWTVNNEEVNPALVRHHKILRDARNDMETAVVGIHFVVTDQHFDNGKLKL------------ 223
            |::.|..|::|:...     |.|::...:.:|..|...........|:|...:            
Human   169 ADIRWFKNDKEIKDV-----KYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATP 228

  Fly   224 RCSAQLHDVYWKTTEKIILETDLFPKHG 251
            :.:.|:.::::..:.|||..|. ||:.|
Human   229 QVAMQVLEIHYTPSVKIIPSTP-FPQEG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 17/73 (23%)
Ig 161..240 CDD:299845 15/90 (17%)
CADM2XP_016861551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.