DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and ceacam1

DIOPT Version :10

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001107266.1 Gene:ceacam1 / 114465 ZFINID:ZDB-GENE-010724-14 Length:1025 Species:Danio rerio


Alignment Length:274 Identity:60/274 - (21%)
Similarity:100/274 - (36%) Gaps:75/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ALTLEMTAALRDVRVRVPHAVRRSEKAILKCFYDIED----------DSLYSVKWYKGRREFYRY 72
            |.||...|..:.:|:..|    .||..:....:.:|:          ..:.|::|.|.  ..|.|
Zfish   282 AATLRYAAVTKTIRIVDP----ISEVVVNSTSFPVENVPFNLRCNVVGPVDSIQWMKD--GVYLY 340

  Fly    73 TPKETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELEV-- 135
            |...|              .:||:.|.:....:.::..|.|.|..| :|.|  .:..|..|.|  
Zfish   341 TDNTT--------------TLSSDNSTLSFKQLALSDDGLYQCTAS-NAVS--DMTQAYNLTVNY 388

  Fly   136 --IETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEE-------VNPALVRHHK 191
              |.|..:.||:..      |||.:..:|:| :|||.:..:|..|...       |..||:::..
Zfish   389 GPINTAVSGPFVAA------VGDSVTFSCSS-NSRPQSQYSWYFNGFNVFNGPVYVTAALLQNQS 446

  Fly   192 IL-----------RDARNDME-TAVVGIHFVVTD-----QHFDNGKLKLRCSA--QLHDVYWKTT 237
            .|           :...|.|. |.:|.:..||.:     |...:....|.|:|  .:..:.|...
Zfish   447 GLYTCMAFNSITGKTNNNSMTLTVLVPVSNVVVNISDGQQPIFSNPFTLTCTASGNVDYIQWMLN 511

  Fly   238 EKIILETDLFPKHG 251
            ..:|     :|:.|
Zfish   512 GAVI-----YPQDG 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 42..118 CDD:472250 15/85 (18%)
Ig strand B 44..48 CDD:409353 0/3 (0%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig 143..240 CDD:472250 27/122 (22%)
Ig strand B 158..162 CDD:409353 0/3 (0%)
Ig strand C 172..176 CDD:409353 0/3 (0%)
Ig strand E 205..209 CDD:409353 1/3 (33%)
Ig strand F 222..227 CDD:409353 2/4 (50%)
Ig strand G 235..238 CDD:409353 0/2 (0%)
ceacam1NP_001107266.1 Ig 30..116 CDD:472250
Ig strand B 35..39 CDD:409353
Ig strand C 47..51 CDD:409353
Ig strand E 82..86 CDD:409353
Ig strand F 96..101 CDD:409353
Ig strand G 108..111 CDD:409353
Ig 134..208 CDD:472250
Ig strand B 138..142 CDD:409353
Ig strand C 151..155 CDD:409353
Ig strand E 173..177 CDD:409353
Ig strand F 187..192 CDD:409353
Ig strand G 202..205 CDD:409353
Ig 221..281 CDD:472250
Ig strand B 232..236 CDD:409353
Ig strand C 245..249 CDD:409353
Ig strand E 260..264 CDD:409353
Ig strand F 274..279 CDD:409353
Ig 307..387 CDD:472250 19/98 (19%)
Ig strand B 317..321 CDD:409353 0/3 (0%)
Ig strand C 330..334 CDD:409353 1/3 (33%)
Ig strand E 352..356 CDD:409353 1/3 (33%)
Ig strand F 366..371 CDD:409353 2/4 (50%)
Ig 403..469 CDD:472250 16/66 (24%)
Ig strand B 407..411 CDD:409353 0/3 (0%)
Ig strand C 420..424 CDD:409353 0/3 (0%)
Ig strand E 437..441 CDD:409353 1/3 (33%)
Ig strand F 448..453 CDD:409353 1/4 (25%)
Ig strand G 463..466 CDD:409353 1/2 (50%)
Ig 492..564 CDD:472250 7/34 (21%)
Ig strand B 493..497 CDD:409353 1/3 (33%)
Ig strand C 506..510 CDD:409353 1/3 (33%)
Ig strand E 528..532 CDD:409353
Ig strand F 542..547 CDD:409353
Ig strand G 557..560 CDD:409353
Ig_3 577..632 CDD:464046
Ig 654..741 CDD:472250
Ig strand B 670..674 CDD:409353
Ig strand C 683..687 CDD:409353
Ig strand E 705..709 CDD:409353
Ig strand F 719..724 CDD:409353
Ig strand G 734..737 CDD:409353
Ig_3 752..809 CDD:464046
Ig 846..918 CDD:472250
Ig strand B 847..851 CDD:409353
Ig strand C 860..864 CDD:409353
Ig strand E 882..886 CDD:409353
Ig strand F 896..901 CDD:409353
Ig strand G 911..914 CDD:409353
Ig_3 925..982 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.