| Sequence 1: | NP_001285975.1 | Gene: | beat-Ia / 34947 | FlyBaseID: | FBgn0013433 | Length: | 437 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001076451.1 | Gene: | f11r.2 / 100005566 | ZFINID: | ZDB-GENE-060531-67 | Length: | 294 | Species: | Danio rerio |
| Alignment Length: | 269 | Identity: | 61/269 - (22%) |
|---|---|---|---|
| Similarity: | 98/269 - (36%) | Gaps: | 51/269 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 12 LTTILLALTLEMTA--ALRDVRVRVPHA-VRRSEKAILKCFYDIEDDSLYSVKW----YKGRREF 69
Fly 70 YRYTPKETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELE 134
Fly 135 VIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEV--NPALVRHHKILRDAR 197
Fly 198 N----DMETAVV-----GIHFVV------TDQHFDNGKL-------------KLRCSAQLHDVYW 234
Fly 235 KTTEKIILE 243 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| beat-Ia | NP_001285975.1 | Ig | 32..118 | CDD:299845 | 22/90 (24%) |
| Ig | 161..240 | CDD:299845 | 22/108 (20%) | ||
| f11r.2 | NP_001076451.1 | Ig | 29..120 | CDD:299845 | 23/103 (22%) |
| IG_like | 29..120 | CDD:214653 | 23/103 (22%) | ||
| Ig_2 | 132..212 | CDD:290606 | 15/79 (19%) | ||
| IG_like | 134..216 | CDD:214653 | 16/81 (20%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||