DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and f11r.2

DIOPT Version :10

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001076451.1 Gene:f11r.2 / 100005566 ZFINID:ZDB-GENE-060531-67 Length:294 Species:Danio rerio


Alignment Length:269 Identity:61/269 - (22%)
Similarity:98/269 - (36%) Gaps:51/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LTTILLALTLEMTA--ALRDVRVRVPHA-VRRSEKAILKCFYDIEDDSLYSVKW----YKGRREF 69
            ||.:.:.|:..:|.  |...|.|..|.. |:.:|...|:|.|..:..:...|:|    .||.:.|
Zfish     2 LTLVFVCLSFSLTGLHASFSVAVNGPIVKVKENEGVDLQCSYTADFGATPRVEWKFRNLKGFQYF 66

  Fly    70 YRYTPKETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELE 134
            ..:..|.|...:         :|::.....:....||.|.:|.|:||||.:.......|..    
Zfish    67 IYFNNKPTVEYE---------QRITVYAGGLRFQKVTRADAGDYNCEVSGNGGYGENTIKL---- 118

  Fly   135 VIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEV--NPALVRHHKILRDAR 197
            |:..|.:.| ::.|......|..:|..|......|.:...|..:|..:  :|......|.|....
Zfish   119 VVSVPPSKP-VSSIPSSVTTGSNVRLTCFDPVGSPPSTYEWYKDNNLLPEDPTKFPIFKNLTYKM 182

  Fly   198 N----DMETAVV-----GIHFVV------TDQHFDNGKL-------------KLRCSAQLHDVYW 234
            |    ::|...|     |.:|.|      ..||.|..|:             |...|.:.|::..
Zfish   183 NAFNGNLEFLSVSKWDAGSYFCVASNENGVSQHGDAVKMEVYDVDSSQVLDVKSNLSMETHNIPG 247

  Fly   235 KTTEKIILE 243
            |.|...|:|
Zfish   248 KITNSHIME 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 42..118 CDD:472250 19/79 (24%)
Ig strand B 44..48 CDD:409353 1/3 (33%)
Ig strand C 59..63 CDD:409353 2/7 (29%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig 143..240 CDD:472250 26/126 (21%)
Ig strand B 158..162 CDD:409353 1/3 (33%)
Ig strand C 172..176 CDD:409353 0/3 (0%)
Ig strand E 205..209 CDD:409353 2/8 (25%)
Ig strand F 222..227 CDD:409353 1/4 (25%)
Ig strand G 235..238 CDD:409353 1/2 (50%)
f11r.2NP_001076451.1 Ig 21..120 CDD:472250 26/111 (23%)
Ig strand B 37..41 CDD:409353 1/3 (33%)
Ig strand C 52..56 CDD:409353 1/3 (33%)
Ig strand E 86..90 CDD:409353 0/3 (0%)
Ig strand F 100..105 CDD:409353 2/4 (50%)
Ig strand G 113..116 CDD:409353 0/2 (0%)
Ig 127..223 CDD:472250 21/96 (22%)
Ig strand B 141..145 CDD:409353 1/3 (33%)
Ig strand C 155..159 CDD:409353 0/3 (0%)
Ig strand E 187..191 CDD:409353 0/3 (0%)
Ig strand F 201..206 CDD:409353 1/4 (25%)
Ig strand G 216..219 CDD:409353 1/2 (50%)

Return to query results.
Submit another query.