DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-Ia and jam2b

DIOPT Version :8

Sequence 1:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001121766.1 Gene:jam2b / 100005301 ZFINID:ZDB-GENE-080229-3 Length:306 Species:Danio rerio

Alignment Length:273 Identity:65/274 (24%)
Similarity:100/274 (36%) Gaps:74/274 (27%)


  Fly    12 LTTILLAL---------TLEMTAALRDVRVRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYK-GR 66
            ||:.||.|         |:..:.|..|        |..:..|:|.|.:..|.::...|:|.| |:
Zfish    17 LTSALLLLIYIPSSDPVTVTTSKAKMD--------VHENTNAVLSCEFRTEKETNPRVEWKKRGK 73

  Fly    67 REFYRYTPKETPPMKVFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAA 131
            ...|.|...:        |.|....|.|.:.:.:.|..||...||.|.|||:|..........:.
Zfish    74 DVSYVYFEGD--------FTGSYKGRASIDGATLTLRGVTQKDSGVYHCEVTARQDKIKLGEVSV 130

  Fly   132 ELEVIETPHNAPFITGIRPRYRVGD-ILRG-----NCTSRHSRPAANLTWTVNNEEVNPALVRHH 190
            .|.|:..||        .|...|.: ::||     :|..:.|.|||..:|..:|:.:|.|  ..|
Zfish   131 TLSVLVPPH--------APTCEVPEAVMRGFSAELHCKDKLSVPAATYSWYKDNKPLNTA--NPH 185

  Fly   191 KILRDARNDMETAVVGIHFVVTDQHFDNGKLKLRCSAQLHDVYWKTTEKIILETDLFPKHGNGA- 254
                |....::|....:.|....:. |.|  :.||.|                     .:|.|| 
Zfish   186 ----DVHYTLDTKTGSLKFKSVSKS-DEG--QYRCEA---------------------SNGVGAP 222

  Fly   255 ---NGNHVNPDDF 264
               .|:|:...:|
Zfish   223 KSCAGHHMKITEF 235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 24/87 (28%)
Ig 161..240 CDD:299845 18/79 (23%)
jam2bNP_001121766.1 Ig 44..135 CDD:299845 27/99 (27%)
IG_like 44..134 CDD:214653 26/98 (27%)
IGc2 154..220 CDD:197706 19/96 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I5410
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.