DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BicC and YLL032C

Sequence 1:NP_476865.1 Gene:BicC FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_013068.1 Gene:YLL032C SGDID:S000003955 Length:825 Species:Saccharomyces cerevisiae

Alignment Length:749 Identity:141/750 (19%)
Similarity:238/750 (32%) Gaps:267/750 (36%)


  Fly     6 SFNKLMY-PS----AADVAKPPMVGLEVEAGSIGSLSSLHALPSTTSVGSGAPSETQSEISSVDS 65
            :|...:| ||    :.|:...|.:..   :|::.|||.|.......|:...:.|.....::::  
Yeast   214 AFKTSIYAPSLITLSRDLKANPQIFF---SGAVHSLSLLARKTLRESISVNSKSFFYRRLTNI-- 273

  Fly    66 DWSDIRAIAMKLGVQNPDDLHTERFKVDRQKLEQLI-KAESSIEGMNGAEYF------------- 116
                           .|..|...| |..:||:.||| |.:|.|...|  ||.             
Yeast   274 ---------------TPGKLLFIR-KYYQQKVNQLILKYQSLIRVTN--EYIEFQSISTNLLEMV 320

  Fly   117 --------FHDIMNT---------------TDTYVSWPCRLKIGAKSKKDP--HVRIVGKVDQVQ 156
                    .|:|:..               .|::........:....|:|.  .:.:||......
Yeast   321 IKNFTIQVLHEIVEVQISLNENCAMSPELIIDSFFGHTGNQIVVITPKEDSFNQLIVVGNQSSTD 385

  Fly   157 RAKE-RILSSLDS-------------RGTRVIMKMDVSYTDHSYIIGRGGNNIKRIM-------- 199
            .|.: .||..|..             |..:.|.::...:.|  :|.|:....:.|||        
Yeast   386 EASDTSILHYLSDFIMGSNQVINPNLRQIKAIFEIHPDFED--FISGKKNGKLTRIMELSACLIQ 448

  Fly   200 -----DDTHTHIH-----FPDSNRS-------NPTEKSNQV-SLC--------GSL--EGVERAR 236
                 :|.:.:::     |||...|       .|.|:|..: .:|        |||  ..:.:..
Yeast   449 LEMEEEDDNLYLNLVSDSFPDFKESFKNVINEFPAEESFFIPEVCHRPIIGTGGSLIQATMRKHN 513

  Fly   237 ALVRLSTPLLISFEMPVMGPNKPQPDHETPYIKMIETKFNVQVIFSTRPKLHTSLVLVKGSEKES 301
            ..::.|.    ||.:|   .||         |.||...   .||.....|...::.|.|...|:.
Yeast   514 VFIQFSN----SFNLP---QNK---------ISMIRYD---NVIIRCPRKNKANICLAKNDLKQI 559

  Fly   302 AQVRDATQ--LLINFACESIASQILVNVQMEISPQHHEIVKGKNNVNLLSIMERTQTKIIFPDLS 364
            .|..|:.|  .||.|:                |.|:..|:......|::..:|:.:...|...|.
Yeast   560 VQEYDSLQSKTLIRFS----------------SGQYRHILHVNGQKNIIGQIEKNENVYIMIPLK 608

  Fly   365 DMNVKPLK-KSQVTISGRIDDVYLARQQLLGNLPVALIFDFP-DNHNDASEIMSLNTKYGVYITL 427
            :    ||. .||::|.|..::...|..:|: |......::|. |...|.      |.:|..|   
Yeast   609 E----PLDGTSQLSIQGNDENASRAANELV-NSAFGYEYEFKIDQEIDP------NKEYEFY--- 659

  Fly   428 RQKQRQSTLAIVVKGVEKFIDKIYEARQEILRLATPFVKPEIPDYYFMPKDKDLNLAYRTQLTAL 492
                   .|.:|     .|:        :|:.:...|.|    |......:||.|....|:...|
Yeast   660 -------NLIVV-----PFL--------QIMNIIVTFEK----DLITFTFEKDTNENTLTKAIEL 700

  Fly   493 LAGYVDSPKT----PSLLPPSLAGQLTPYANNNHLLLNANGLATPTGVCAPTQKYMQLHNSFQQA 553
            |:.|:::.||    ..::...:.|..:..:|.:    |:|                         
Yeast   701 LSNYLETQKTKIIFKKIIKKFVLGSASSKSNTS----NSN------------------------- 736

  Fly   554 QNRSMVAGGQSNNGNYLQVPGAVAPPLKPPTVSPRNSCSQNTSGYQSFSSSTTSLEQSYPPYAQL 618
                       .|||:.               |..|:.|:.|       ...||...:.|...::
Yeast   737 -----------TNGNFR---------------SMNNAKSRTT-------IDNTSQSGASPQRHKM 768

  Fly   619 PGTVSSTSSSTAGSQNRAHYSPDSTYGSEGGGVG 652
            |     ..::..|:|....|.|::.|...|.|.|
Yeast   769 P-----VITTVGGAQAIKGYIPNTYYNGYGYGYG 797

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087 19/102 (19%)
vigilin_like_KH 327..393 CDD:239087 15/67 (22%)
SAM_BICC1 805..868 CDD:188919
SAM 807..867 CDD:197735
YLL032CNP_013068.1 COG5166 2..704 CDD:227495 115/588 (20%)
vigilin_like_KH 484..557 CDD:239087 20/92 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131144235
eggNOG 1 0.900 E1_KOG2208
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10627
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.