DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BicC and Bicc1

Sequence 1:NP_476865.1 Gene:BicC FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_113574.1 Gene:Bicc1 MGIID:1933388 Length:977 Species:Mus musculus

Alignment Length:1037 Identity:316/1038 (30%)
Similarity:470/1038 (45%) Gaps:232/1038 (22%)


  Fly    34 GSLSSLHALPSTTSVGSGAPSETQSEISSVDSD------------WSDIRAIAMKLGVQNPDDLH 86
            |.|::..:.|     ||.:...|.|.::..:.|            ||:                 
Mouse     8 GYLAAAQSDP-----GSNSERSTDSPVAGSEDDLVAAAPLLHSPEWSE----------------- 50

  Fly    87 TERFKVDRQKLEQLIKAESSIEGMNGAEYFFHDIMNTTDTYVSWPCRLKIGAKSKKDPHVRIVGK 151
             |||:|||:|||.:::|.:..:|.:| |.||..||..|:|.::||.:||||||||||||:::.||
Mouse    51 -ERFRVDRKKLEAMLQAAAEGKGRSG-EDFFQKIMEETNTQIAWPSKLKIGAKSKKDPHIKVSGK 113

  Fly   152 VDQVQRAKERILSSLDSRGTRVIMKMDVSYTDHSYIIGRGGNNIKRIMDDTHTHIHFPDSNRSNP 216
            .:.|:.|||.|:|.||::..||.:|||||:|:||::||:||||||::|:||..|||||||||:|.
Mouse   114 KEDVKEAKEMIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEDTGCHIHFPDSNRNNQ 178

  Fly   217 TEKSNQVSLCGSLEGVERARALVRLSTPLLISFEMPVMGPNKPQPDHETPYIKMIETKFNVQVIF 281
            .|||||||:.|...|||.|||.:|...||::.||:|:.|..:|.||..||.|:.|...::|.|.|
Mouse   179 AEKSNQVSIAGQPAGVESARARIRELLPLVLMFELPIAGILQPVPDPNTPSIQHISQTYSVSVSF 243

  Fly   282 STRPKLHTSLVLVKGSEKESAQVRDATQLLINFACESIASQILVNVQMEISPQHHEIVKGKNNVN 346
            ..|.:::.:.|.|:||:..:..|::.|.:|:.....|:||.|.|:.|::|:.|||..:.|:|..|
Mouse   244 KQRSRMYGATVTVRGSQNNTNAVKEGTAMLLEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSN 308

  Fly   347 LLSIMERTQTKIIFPDLSDMNVKPLKKSQVTISGRIDDVYLARQQLLGNLPVALIFDF-PDNHND 410
            :..||:||..:|.|||.|:    |.|||.|.:.|.|:.|.||||.|:|.||:.|:||. .|...|
Mouse   309 VKHIMQRTGAQIHFPDPSN----PQKKSTVYLQGTIESVCLARQYLMGCLPLVLMFDMKEDIEVD 369

  Fly   411 ASEIMSLNTKYGVYITLRQKQRQSTLAIVVKGVEKFIDKIYEARQEILRL-------ATPFVKPE 468
            ...|..|..:..|:|:::.|.:|.:.:::||.||:....:||||:.:|.|       ||......
Mouse   370 PQVIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLESSGVSIATSLSPAS 434

  Fly   469 IPDYYFMPK-----------------------------DKDLNLAYRTQLTALLAGYVDSPKTPS 504
            .|.....|.                             ...|..|..|.::.|.:....:| :|:
Mouse   435 CPAGLACPSLDILASAGLGLTGLGLLGPTTLSLNTSATPNSLLNALNTSVSPLQSSSSGTP-SPT 498

  Fly   505 LLPPSLA--GQLTPYANNNHLLLNANGLATPTGVC---APTQKY-----------MQLHNSFQQA 553
            |..|.:|  ...|.::...||:|.:...||.|.:.   .||..:           :.:|.:..|.
Mouse   499 LWAPPIANTASATGFSTIPHLMLPSTAQATLTNILLSGVPTYGHTAPSPPPGLTPVDVHINSMQT 563

  Fly   554 QNRSMVAGGQSNNGNYLQVPGAVAPPLKPPTV------SPRNSCSQNTSGYQSFSSSTTSLEQSY 612
            :.:::.|   |.|| ::|.......||...::      |.....|..|:|.:..|..:.|:|...
Mouse   564 EGKNISA---SING-HVQPANMKYGPLSTSSLGEKVLSSNHGDPSMQTAGPEQASPKSNSVEGCN 624

  Fly   613 PPYAQLPGTVSSTSSSTAGSQNRAHYSPDSTYGSEGGGVGGGGGGGARLGRRLSDGVLLGLSNSN 677
            ..:.::....|.:.|..||...:..                 |.......:|.:..:|.|..||:
Mouse   625 DAFVEVGMPRSPSHSGNAGDLKQML-----------------GASKVSCAKRQTVELLQGTKNSH 672

  Fly   678 GGGGNSGGAHLL-----------------PGS--------AESYRSLHYDLGGNKHSGH-RAFDF 716
            ..|.:    .||                 |||        |...:|....|.......| :|||:
Mouse   673 LHGTD----RLLSDPELSATESPLADKKAPGSERAAERAAAAQQKSERARLASQPTYVHMQAFDY 733

  Fly   717 DMKRALGYKAMERTPVAGELRTPTTAWMGMGLSSTSPAPAPLE---------------------- 759
            :.|:.|..|||.:.||..|:||||..|.|:|.|.:.||....|                      
Mouse   734 EQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRANHVSYKPTMTTAYEGSSL 798

  Fly   760 -----NGENGAAGGGASSGWRLPPGLGSPYG---LSATTGLLDATPVNRRMQLAKH--------- 807
                 :.....|.|..|..||...|:| |.|   .||..|    :|..::.:..:|         
Mouse   799 SLSRSSSREHLASGSESDNWRDRNGIG-PMGHSEFSAPIG----SPKRKQNKSREHYLSSSNYMD 858

  Fly   808 -------------------KDIQTLLTSLGLEHYIKIFVLNEIDLEVFTTLTEENLMELGIAAFG 853
                               .|:..|.:.|||..|..:|...||||:.|.|||:::|.||||..||
Mouse   859 CISSLTGSNGCNLNSCFKGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFG 923

  Fly   854 ARKKLLTAIHTLLANEAACSTMPSSSSSQNSSSPRFSGSAAPGAERRP----------SNQW 905
            ||:|:|.||..|..|.......|      |:|...|....|.|  |.|          |.:|
Mouse   924 ARRKMLLAISELSKNRRKLFEPP------NASCTSFLEGGASG--RLPRQYHSDIASVSGRW 977

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087 43/66 (65%)
vigilin_like_KH 327..393 CDD:239087 30/66 (45%)
SAM_BICC1 805..868 CDD:188919 30/91 (33%)
SAM 807..867 CDD:197735 30/88 (34%)
Bicc1NP_113574.1 vigilin_like_KH <80..125 CDD:239087 25/45 (56%)
vigilin_like_KH 136..202 CDD:239087 43/66 (65%)
vigilin_like_KH 288..351 CDD:239087 30/67 (45%)
SAM_BICC1 875..938 CDD:188919 29/63 (46%)
SAM 878..935 CDD:197735 28/57 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2208
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 398 1.000 Inparanoid score I1934
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003563
OrthoInspector 1 1.000 T1082874
orthoMCL 1 0.900 OOG5_131992
Panther 1 1.100 LDO PTHR10627
Phylome 1 0.910 0.944 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3867
TreeFam 1 0.960
1110.860

Return to query results.
Submit another query.