| Sequence 1: | NP_476865.1 | Gene: | BicC / 34946 | FlyBaseID: | FBgn0000182 | Length: | 905 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_197757.1 | Gene: | AT5G23680 / 832433 | AraportID: | AT5G23680 | Length: | 295 | Species: | Arabidopsis thaliana | 
| Alignment Length: | 346 | Identity: | 80/346 - (23%) | 
|---|---|---|---|
| Similarity: | 117/346 - (33%) | Gaps: | 99/346 - (28%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   558 MVAGGQSNNGNYLQVPGAVAPPLKPPTVSPRNSCSQNTSGYQSFSSSTTSLEQSYPPYAQLPGTV 622 
  Fly   623 SSTSSSTAGSQNRAHY-----SPDSTYGSEGGGVGGGGGGGAR------LGRRLSDGVLLGLSN- 675 
  Fly   676 SNGGGGNSGGAHLLPGSAESYRSLHYDLGGNKHSGHRAFDFDMKRALGYKAMERTPVAGELRTPT 740 
  Fly   741 TAWMGMGLSSTSPAPAPLENGENGAAGGGASSGWRLPPG----------LGSPYGLSATTGLLDA 795 
  Fly   796 TPVNRRMQLAKHKDIQTL----------------LTSLGLEHYIKIFVLNEIDLEVFTTLTEENL 844 
  Fly   845 MELGIAAFGARKKLLTAIHTL 865 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| BicC | NP_476865.1 | vigilin_like_KH | 174..240 | CDD:239087 | |
| vigilin_like_KH | 327..393 | CDD:239087 | |||
| SAM_BICC1 | 805..868 | CDD:188919 | 23/77 (30%) | ||
| SAM | 807..867 | CDD:197735 | 23/75 (31%) | ||
| AT5G23680 | NP_197757.1 | SAM_superfamily | 235..289 | CDD:188886 | 21/53 (40%) | 
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4374 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0004093 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR10627 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 3.000 | |||||