DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BicC and Anks6

Sequence 1:NP_476865.1 Gene:BicC FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_001343355.1 Gene:Anks6 MGIID:1922941 Length:883 Species:Mus musculus

Alignment Length:922 Identity:185/923 (20%)
Similarity:319/923 (35%) Gaps:289/923 (31%)


  Fly   134 LKIGAKSKKDPHVRIVGKVDQVQRAKERILSSLDSR---GTRVIMK------MDVSY--TDHS-- 185
            |::.|....:|.||.:     ::|.     :|::||   |...:|:      :.|::  .||.  
Mouse    73 LQLAAAGGHEPLVRFL-----LRRG-----ASVNSRNHYGWSALMQAARCGHVSVAHLLLDHGAD 127

  Fly   186 ------------YIIGRGGN--NIKRIMDDTHTHIHFPDSNRSNPTEKSNQ--VSLCGSLEGVER 234
                        .:..|||:  .:|.:::......|...|..|..|..|..  :.:...:..|:.
Mouse   128 VNAQNRLGASVLTVASRGGHLGVVKLLLEAGAIVDHHTPSGESPATGGSGDELLGITALMAAVQH 192

  Fly   235 A-RALVRLS----------------TPLL---------ISFEMPVMGPNKPQPDH-----ETPYI 268
            . .|:|||.                :||:         ::.::...|.|   |||     :|.:.
Mouse   193 GHEAVVRLLMEWGADPNHTARTVGWSPLMLAALLGKLNVAQQLVEKGAN---PDHLSVLEKTAFE 254

  Fly   269 KMIETKFN-----VQVIFSTRPKLHTSLVLVKGSEKESAQVRDATQLLINFACESIASQILVNVQ 328
            ..::.|:.     :..:.:.|||        ...||....:..|.: :.||       |::..:.
Mouse   255 VALDRKYRDLAEYLDPLTTVRPK--------TDEEKRRPDIFYALK-MGNF-------QLVKEIA 303

  Fly   329 MEISPQHHEIVKGKNNVNLLSIMERTQTKIIFPDLSDMNVKPLKKSQVTISGRIDDVYLARQQLL 393
            .| .|.|..:|.|.                        ...||..:.||                
Mouse   304 DE-DPNHVNLVNGD------------------------GATPLMLAAVT---------------- 327

  Fly   394 GNLPVALI-------FDFPDN-----------HNDASEIMSLNTKYGVYITLRQKQRQSTLAIVV 440
            |:||:..:       .|..|:           ::...||:......|..:.||.|...:...:|:
Mouse   328 GHLPLVQLLVEKHADMDKQDSVHGWTALMQATYHGNKEIVKYLLNQGADVALRAKNGYTAFDLVM 392

  Fly   441 KGVEKFIDKIYEARQEILRL------------ATPFVKPEIP--------DYYFMPKDKDLNLAY 485
                    .:.:...|::||            ..|..:|.:|        ....:|.||....::
Mouse   393 --------LLNDPDTELVRLLASVCMQVNKDRGRPSHRPPLPHSKARQPWSIPVLPDDKGGLKSW 449

  Fly   486 RTQLTALLAGYVDSPKTPSLLPPSL-AGQLTPYANNNHLLLNANGLATP---TGVCAPTQKYMQL 546
            .::    ::......|....||..| |.|..|:::...|.|::...|.|   |....|.:.....
Mouse   450 WSR----MSNRFRKLKLMQTLPRGLAANQPLPFSDEPELALDSTMRAPPQDRTSHLGPPEAAHAT 510

  Fly   547 HNSFQQAQNRS----MVAGGQSNNGNYLQVPG----AVAPPLKPPTVSPRNSCSQNTSGYQSFSS 603
            .:|......|.    ::.....|...:.::|.    ||.||..||            |.::.:||
Mouse   511 KDSGPGNPRREKGDVLLTTMLRNGAPFPRLPSDKLKAVIPPFLPP------------SSFELWSS 563

  Fly   604 STTSLEQSYPPYAQLPGTVSSTSSSTAGSQNRAHYSPDSTYGSEGG--------GVGGGGGGGAR 660
                 ::|:..:   .|....|.::.....:|||  |....|::|.        .:.......| 
Mouse   564 -----DRSHTCH---NGKADPTKTALPPRASRAH--PVGCVGTDGATSRPVKFPSISRSPASPA- 617

  Fly   661 LGRRLSDGVLLGLSNSNGGGGNSGGAHLLPGSAESYRSLHYDLGGNKHSGHRAFDFDMKRALG-- 723
                 |.|......:|:||....||...|.|      .||...||:..|.........|:|.|  
Mouse   618 -----SSGSFNHSPHSSGGASGIGGMSRLGG------ELHSRSGGSVDSVLSQIAAQRKKAAGLC 671

  Fly   724 -YKAMERTPVAGELRTPTTAWMGMGLSSTSPAPAPLENGENGAAGGGASSGWRLPPGLGSPYGLS 787
             .|..:::...|    |.|:      ||....||.|.:..:|::.|.:||. :|.|....|.|.|
Mouse   672 EQKPRQQSSPVG----PATS------SSPPELPASLPSSGSGSSSGPSSSK-KLDPSKRPPSGTS 725

  Fly   788 ATT-------------------GLLDATPVNRRMQ---------LAKHKDIQTLLTSLGLEHYIK 824
            ||:                   ..:.::..:|:.:         :....::..:|..|.||.|..
Mouse   726 ATSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGILKKLSLEKYQP 790

  Fly   825 IFVLNEIDLEVFTTLTEENLMELGIAAFGARKKLLTAIHTLLA-----NEAACSTMPSSSSSQNS 884
            ||...|:|:|.|.|||:.:|.||||...|:|:::|.||..|.|     .:....|:.:..||..|
Mouse   791 IFEEQEVDMEAFLTLTDGDLQELGIKTDGSRQQILAAISELNAGKGRERQILQETIHNFHSSFES 855

  Fly   885 SSPRFSGSAAPG 896
            |:   |.:.|||
Mouse   856 SA---SNTRAPG 864

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087 16/93 (17%)
vigilin_like_KH 327..393 CDD:239087 9/66 (14%)
SAM_BICC1 805..868 CDD:188919 26/68 (38%)
SAM 807..867 CDD:197735 25/60 (42%)
Anks6NP_001343355.1 ANK 1 8..37
Ank_4 9..89 CDD:316185 5/21 (24%)
ANK repeat 9..66 CDD:293786
ANK 63..202 CDD:238125 28/139 (20%)
ANK 2 68..97 7/34 (21%)
ANK repeat 69..99 CDD:293786 9/36 (25%)
ANK repeat 101..132 CDD:293786 5/31 (16%)
ANK 3 101..130 5/29 (17%)
ANK repeat 134..163 CDD:293786 4/29 (14%)
ANK 4 134..163 4/29 (14%)
ANK repeat 167..210 CDD:293786 9/43 (21%)
ANK 5 181..210 5/29 (17%)
ANK 182..371 CDD:238125 39/249 (16%)
ANK repeat 214..241 CDD:293786 3/27 (11%)
ANK 6 215..244 6/32 (19%)
Ank_2 220..347 CDD:315466 30/187 (16%)
ANK 7 282..312 8/39 (21%)
ANK repeat 316..347 CDD:293786 8/71 (11%)
ANK 8 316..345 8/69 (12%)
ANK repeat 350..380 CDD:293786 4/30 (13%)
ANK 9 350..379 3/29 (10%)
Ank_2 355..>415 CDD:315466 10/68 (15%)
ANK 10 383..414 4/39 (10%)
ANK repeat 383..411 CDD:293786 4/36 (11%)
SAM_ANKS6 769..833 CDD:188917 25/64 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10627
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.