DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BicC and Hdlbp

Sequence 1:NP_476865.1 Gene:BicC FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_742036.2 Gene:Hdlbp RGDID:620962 Length:1268 Species:Rattus norvegicus

Alignment Length:582 Identity:127/583 (22%)
Similarity:212/583 (36%) Gaps:160/583 (27%)


  Fly     6 SFNKLMYPSAADVAKPPMVGLEVEAGSIGSLSSLHALP-----STTSVGSGAPSETQSEISSVDS 65
            |..:::..:...|..||       :.||.....|...|     :.|.|.:.|.|.|.|.:|:  .
  Rat   317 SLQEILERTGVSVEIPP-------SDSISETVILRGEPEKLGQALTEVYAKANSFTVSSVSA--P 372

  Fly    66 DWSDIRAIAMKLG------VQNPDDLHTERFKVDRQKL------EQLIKAESSIEGM-----NGA 113
            .|.. |.|..|.|      .|....:|.| |.....|:      |.:..|:..||||     |..
  Rat   373 SWLH-RFIIGKKGQNLAKITQQMPKVHIE-FTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRM 435

  Fly   114 EYF-------FH---------DIMNTTDTY-VSWPCRLKIGAKSKKDPHVRIVGKVDQVQRAKER 161
            :|.       ||         :|....|.| ||    ::|...|:|...:||.|....||:||..
  Rat   436 DYVEINIDHKFHRHLIGKSGANINRIKDQYKVS----VRIPPDSEKSNLIRIEGDPQGVQQAKRE 496

  Fly   162 IL---SSLDSRGTRVIMKMDVSYTDHSYIIGRGGNNIKRIMDD-THTHIHFPDSNRSNPTEKSNQ 222
            :|   |.:::..|:.::   :....|..|||:.|..|:.|.|. ....|:|||     |.:||..
  Rat   497 LLELASRMENERTKDLI---IEQRFHRTIIGQKGERIREIRDKFPEVIINFPD-----PAQKSEI 553

  Fly   223 VSLCGSLEGVERARALVR------------LSTPLLISFEMPVMGP----------------NKP 259
            |.|.|....||:....::            :|.|:...|...::|.                :.|
  Rat   554 VQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLP 618

  Fly   260 QPDHETPYIKMIETKFN------------------VQVIFSTRPKLHTSLVLVKGS--------- 297
            ..:..:..|.:...:.|                  .:|..|...|||.||:..||.         
  Rat   619 AENSNSETIVITGKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEEC 683

  Fly   298 -------------------EKESAQVRDATQLLINFACESIASQILVNVQMEISPQHHEIVKGKN 343
                               ...|:.|..|.:.|::.|.|.......|:::.:  |::|:.:.||.
  Rat   684 GGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLAEEKQTKSFTVDIRAK--PEYHKFLIGKG 746

  Fly   344 NVNLLSIMERTQTKIIFPDLSDMNVKPLKKSQVTISGRIDDVYLARQQL------LGNLPVALIF 402
            ...:..:.:.|..:||||...|.:     :..:||.|:.|.|..|:::|      |.|:....:.
  Rat   747 GGKIRKVRDSTGARIIFPAAEDKD-----QDLITIIGKEDAVREAQKELEALIQNLDNVVEDYML 806

  Fly   403 DFPDNHND-----ASEIMSLNTKY-GVYITLRQKQRQSTLAIVVKGVEKFIDKIYEARQEIL 458
            ..|.:|..     ...:..:..:| ||.::..:...||. .:.:||.:..::...:..|||:
  Rat   807 VDPRHHRHFVIRRGQVLREIAEEYGGVMVSFPRSGTQSD-KVTLKGAKDCVEAAKKRIQEII 867

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087 20/67 (30%)
vigilin_like_KH 327..393 CDD:239087 17/72 (24%)
SAM_BICC1 805..868 CDD:188919
SAM 807..867 CDD:197735
HdlbpNP_742036.2 vigilin_like_KH 152..213 CDD:239087
vigilin_like_KH 224..283 CDD:239087
vigilin_like_KH 297..357 CDD:239087 9/47 (19%)
vigilin_like_KH 368..425 CDD:239087 14/61 (23%)
vigilin_like_KH 438..498 CDD:239087 17/64 (27%)
vigilin_like_KH 509..571 CDD:239087 21/70 (30%)
vigilin_like_KH 583..644 CDD:239087 7/61 (11%)
vigilin_like_KH 655..717 CDD:239087 13/62 (21%)
vigilin_like_KH 729..791 CDD:239087 18/69 (26%)
vigilin_like_KH 802..864 CDD:239087 9/63 (14%)
vigilin_like_KH 875..968 CDD:239087
vigilin_like_KH 974..1035 CDD:239087
vigilin_like_KH 1055..1118 CDD:239087
vigilin_like_KH 1129..1191 CDD:239087
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113521096
eggNOG 1 0.900 E1_KOG2208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.