DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BicC and Dp1

Sequence 1:NP_476865.1 Gene:BicC FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_001286573.1 Gene:Dp1 FlyBaseID:FBgn0027835 Length:1301 Species:Drosophila melanogaster

Alignment Length:505 Identity:104/506 (21%)
Similarity:195/506 (39%) Gaps:116/506 (23%)


  Fly    48 VGSGAPS------ETQSEIS-SVDSDWSDIRAIAMKLGVQNPDDLHTERFKVDRQKLEQLIKAES 105
            :|.|..:      |||::|. ..:.|.:::..|..|  .:|..:. .||.:..:.:|..::..|.
  Fly   612 IGKGGANIKKIRDETQTKIDLPAEGDTNEVIVITGK--KENVLEA-KERIQKIQNELSDIVTEEV 673

  Fly   106 SIEGMNGAEYFFHDIMNTTDTYVS---WPC---RLKIGAKSKKDPHVRIVGKVDQVQRAKERILS 164
            .|     ...:::.|:.|....:|   ..|   .:|......|...|.|.|..|.|::||.::|.
  Fly   674 QI-----PPKYYNSIIGTGGKLISSIMEECGGVSIKFPNSDSKSDKVTIRGPKDDVEKAKVQLLE 733

  Fly   165 SLDSRGTRVIMKMDVSYT--------DHSYIIGRGGNNIKRIMDDTHTHIHFPDSNRSNPTEKSN 221
            ..:.|..       .|:|        .|.::||:.|.:|::|.|.|...|.||    ||......
  Fly   734 LANERQL-------ASFTAEVRAKQQHHKFLIGKNGASIRKIRDATGARIIFP----SNEDTDKE 787

  Fly   222 QVSLCGSLEGVERARALVRLSTPLLISFEMPVMGPNKPQPDHETPYI--------KMIETKFNVQ 278
            .:::.|..|.|::||..:.   .::...:....|.....|.|...::        ::.|....|.
  Fly   788 VITIIGKEESVKKAREQLE---AIIKECDEVTEGEVSVDPKHHKHFVAKRGFILHRISEECGGVM 849

  Fly   279 VIFSTRPKLHTSLVLVKGSEK--ESAQVRDATQLLINFACESIASQILVNVQME-ISPQ-HHEIV 339
            :.| .|..:::..|.:||::.  |:|:.|          .|.|.:.:.....:| :.|| ||..:
  Fly   850 ISF-PRVGINSDKVTIKGAKDCIEAARQR----------IEEIVADLEAQTTIEVVIPQRHHRTI 903

  Fly   340 KGKNNVNLLSIMERTQTKIIFPDL-------------------------------SDMNVKPLKK 373
            .|.....:..:......:|.|||.                               .:...:|:::
  Fly   904 MGARGFKVQQVTFEFDVQIKFPDRDATEPVEGLTNGGSGENGGENEGQEGEQEVEKEAEQEPVRQ 968

  Fly   374 SQV-TISGRIDDVYLARQQLLGNLPVALIFDFP-DNHND-----ASEIMSLNTKYGVYITLRQKQ 431
            ..| .|:|||:....|:|.||..:|:......| |.|..     .:.:....:|:.|::.|...:
  Fly   969 CDVIRITGRIEKCEAAKQALLDLIPIEEELSVPFDLHRTIIGPRGANVRQFMSKHDVHVELPPSE 1033

  Fly   432 RQSTLAIVVKGVEKFIDKIYEARQEILRLATPFVKPEIPDYYFMPKDKDL 481
            .:|.: |.|.|...   ::.|||:.::::        |.||.....|::|
  Fly  1034 LKSDV-IKVCGTPA---RVAEAREALVKM--------IEDYEADRADREL 1071

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087 20/74 (27%)
vigilin_like_KH 327..393 CDD:239087 19/100 (19%)
SAM_BICC1 805..868 CDD:188919
SAM 807..867 CDD:197735
Dp1NP_001286573.1 vigilin_like_KH 170..231 CDD:239087
vigilin_like_KH 242..>290 CDD:239087
vigilin_like_KH 315..373 CDD:239087
vigilin_like_KH 384..440 CDD:239087
vigilin_like_KH 454..513 CDD:239087
vigilin_like_KH 524..586 CDD:239087
vigilin_like_KH 598..659 CDD:239087 12/50 (24%)
vigilin_like_KH 670..732 CDD:239087 15/67 (22%)
vigilin_like_KH 744..806 CDD:239087 19/66 (29%)
vigilin_like_KH 817..879 CDD:239087 13/73 (18%)
vigilin_like_KH 890..989 CDD:239087 19/99 (19%)
vigilin_like_KH 995..1055 CDD:239087 13/64 (20%)
vigilin_like_KH 1075..1137 CDD:239087
vigilin_like_KH 1149..1208 CDD:239087
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113499452
eggNOG 1 0.900 E1_KOG2208
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10627
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.