DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BicC and RGD1563104

Sequence 1:NP_476865.1 Gene:BicC FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_001100437.1 Gene:RGD1563104 RGDID:1563104 Length:1250 Species:Rattus norvegicus

Alignment Length:466 Identity:98/467 (21%)
Similarity:191/467 (41%) Gaps:97/467 (21%)


  Fly    72 AIAMKLGVQNPDDLHTERFKVDRQKLEQLIKAESSIEGMNGAEYFFHDIMNTTDTYVSWPCRLK- 135
            ||..|:..:|...:    ..|...:|...|:.|....|:..|:....|:.|..:...|....:| 
  Rat   443 AILNKIAERNQVSI----TMVPENELNHTIRIEGESLGVQQAKKELLDLANNLEEEYSQDIIIKH 503

  Fly   136 ------IGAKSKK--------------DPH-------VRIVGKVDQVQRAKERILSSL-DSRGTR 172
                  ||.|.::              .||       |:::|...:.::..:.:.:.| |.:...
  Rat   504 QFHHILIGQKGERVREICKKFPDVILNFPHPAEKSDIVQLIGPRYESEKCAQYLENMLTDIKENN 568

  Fly   173 VIMKMDVSYTDHSYIIGRGGNNIKRIMDDTHTHIHFPDSNRSNPTEKSNQVSLCGSLEGVERARA 237
            ..:.:.:....|..:||:|.:|||:|.:.|:|.|.||..|.:     |.:..:.|..|..|.||.
  Rat   569 YSISISIIKKLHKRLIGKGASNIKKISETTNTKISFPPENCN-----SEEFIITGYPENCEIARN 628

  Fly   238 -LVRLSTPLLISFEMPVMGP-------NKPQPDHETPYIKMIETKFNVQVIFSTRPKLHTSL--V 292
             ::.:...:..:.|..:..|       |.|:   |.....:||....:.:.|   ||..:||  |
  Rat   629 WILSIQQEIADTAEEEITIPTNLYKYLNNPK---ECLLNSIIEECGKIHLHF---PKNKSSLNKV 687

  Fly   293 LVKGSEKESAQVRDATQLLINFACESIASQILVNVQMEISPQHHEIVKGKNNVNLLSIMERTQTK 357
            ::.||.:   .|..|...|:..|.|..|..  .:.::.:..|:|:.:..||..|:..|.:.|.|.
  Rat   688 IIMGSVE---SVEKAKAKLLKLAEEEQAKN--YSEKIRVKSQYHQFLVNKNGGNISQICDETGTC 747

  Fly   358 IIFPDLSDMNVKPLKKSQVTISGRIDDVYLARQQLLGNLPVALIFDFPDNHNDASEIMSLNTKY- 421
            ::||:.::.:     :..:||:|..:.|...:::|     ..|:.||   .|:..:.:.:|.:: 
  Rat   748 VLFPNHTNKD-----QESLTITGSEESVKEVQKRL-----EDLVKDF---ENEVDDSILINRRFH 799

  Fly   422 -------------------GVYITLRQKQRQSTLAIVVKGVEKFIDKIYEARQEILRLATPFVKP 467
                               ||.||.....||:| .:.:||.:..::   .|::.|..:..| :..
  Rat   800 HYFVMRRGQLLKEMTEEYGGVVITFSYAGRQNT-KVTIKGAKPCVE---AAKKHIKAIFEP-LGS 859

  Fly   468 EIPDYYFMPKD 478
            ::...|.:|::
  Rat   860 QVTTRYVIPQN 870

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087 20/67 (30%)
vigilin_like_KH 327..393 CDD:239087 15/66 (23%)
SAM_BICC1 805..868 CDD:188919
SAM 807..867 CDD:197735
RGD1563104NP_001100437.1 vigilin_like_KH 356..410 CDD:239087
vigilin_like_KH 426..485 CDD:239087 10/46 (22%)
vigilin_like_KH 496..558 CDD:239087 9/62 (15%)
vigilin_like_KH 570..631 CDD:239087 20/66 (30%)
KH-I 642..699 CDD:294072 16/66 (24%)
vigilin_like_KH 716..778 CDD:239087 15/72 (21%)
vigilin_like_KH 791..851 CDD:239087 12/64 (19%)
KH-I 867..952 CDD:294072 1/5 (20%)
vigilin_like_KH 959..1020 CDD:239087
vigilin_like_KH 1042..1102 CDD:239087
vigilin_like_KH 1113..1174 CDD:239087
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113521076
eggNOG 1 0.900 E1_KOG2208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.