DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: BicC and gld-3

Sequence 1:NP_476865.1 Gene:BicC FlyBaseID:FBgn0000182 Length:905 Species:Drosophila melanogaster
Sequence 2:NP_495479.2 Gene:gld-3 WormBaseID:WBGene00001597 Length:969 Species:Caenorhabditis elegans

Alignment Length:649 Identity:136/650 (21%)
Similarity:244/650 (38%) Gaps:182/650 (28%)


  Fly   114 EYFFHDIMNTTDTYVSWPCRLKIGAKSKKDPHVRIVGKVDQVQRAKERILSS----LDSRGTRVI 174
            |.|:||...:.........|.::...:|::.|:..:       :|:...|.|    ::...|||.
 Worm    58 ENFYHDFQQSAQMAEDANQRRQVSYNTKREAHIHQL-------KAQGLPLPSNIPMIEINPTRVT 115

  Fly   175 MKMDVSYTDHSYIIGRGGN--NIKRIMDDTHTHIHFPDSN--RSNPTEKSNQVSLCGSLEGVERA 235
            :.|:.....:|.:....|:  |:..||.:|:|.|..||.:  .:.|...:.||::.|....|:||
 Worm   116 LNMEFESQYYSLMTSDNGDHENVASIMAETNTLIQLPDRSVGGTTPDPFAQQVTITGYFGDVDRA 180

  Fly   236 RALVRLSTPLLISFEMPVMGPNKPQPDHE-TPYIKMIETKFNVQVIFSTRPK---LHTSLVLVKG 296
            |.|:|.:....:...:..|    ..|.|| ..:::....: ||::.|...|:   :.|:.:.:..
 Worm   181 RMLMRRNCHFTVFMALSKM----KMPLHELQAHVRQNPIQ-NVEMSFVDAPEKNGIVTTYLRITA 240

  Fly   297 SEKESAQVRDATQLL--INFACESIASQILVNVQMEISPQHHEIVKGKNN-VNLLSIMERTQTKI 358
            .||...::.:|.:.|  |.|. ||.|.:....:...:|..:.:.|.|.:: ..|:.::||..|.|
 Worm   241 REKNQHELIEAAKRLNEILFR-ESPAPENNFTLHFTLSTYYVDQVLGSSSTAQLMPVIERETTTI 304

  Fly   359 I-FPDLSDMNVKPLKKSQVTISGRIDDVYLARQQLLGNLPVALIFDF-------PDNHNDASEIM 415
            | :|..::.|.......::.:.|.||:|..||:.::..||:::.|:.       |...:|.:..|
 Worm   305 ISYPCYNNRNETRGNIYEIKVVGNIDNVLKARRYIMDLLPISMCFNIKNTDMAEPSRVSDRNIHM 369

  Fly   416 SLNTKYGVYI----------------------TLRQKQRQSTLAIVVKGVEKFIDKIYEARQEIL 458
            .:: :.|:.:                      :||.|             |..|.|:|.|.|::|
 Worm   370 IID-ESGIILKMTPSVYEPADLLSGEVPLNCASLRSK-------------EFNIKKLYTAYQKVL 420

  Fly   459 RLATPFVKPEIPDY------YFMPKD--KDLNLAYRTQLTALLAG----------------YVDS 499
            .....|:.|:..||      :.:|.:  |:.|:..|.:|:....|                |:..
 Worm   421 SKKFDFIAPQPNDYDNSIWHHSLPANFLKNFNMPCRGELSDGSNGRRHRSSSIASSRSKHSYMSK 485

  Fly   500 PK--------------------------------TPSLLPPSLAGQLTPYANNNHLLLNANGLAT 532
            .|                                ||...||    .|||:   :|:|        
 Worm   486 GKQFSESSGGPSRSHTRVSSFSENSSTVPIMQFPTPHFAPP----MLTPH---HHML-------- 535

  Fly   533 PTGVCAPTQKYMQLHNSFQQAQNRSMVAGGQSNNGNYLQVPGAV--------APPLKPPTV---- 585
                   ...|:|.|   ||||.....|.| .:.|.::..|..:        |.|...|.|    
 Worm   536 -------KYVYLQQH---QQAQTFLKGAAG-LHPGTHIMFPPPIIVDGSFVSALPFADPVVFDGF 589

  Fly   586 ------SPRNSCSQNTSGYQSFSSSTTSLEQSYPPYAQLPGTVSSTSSSTAGSQNRAHYSPDST 643
                  .|.|...|:.:..:| |.|..|.::...|...:....||::.|         |.|.:|
 Worm   590 PYVHGLFPVNEAEQHRNHRES-SPSLRSTQEIRKPSRNMGNRPSSSTGS---------YYPSTT 643

Known Domains:


GeneSequenceDomainRegion External IDIdentity
BicCNP_476865.1 vigilin_like_KH 174..240 CDD:239087 20/70 (29%)
vigilin_like_KH 327..393 CDD:239087 17/68 (25%)
SAM_BICC1 805..868 CDD:188919
SAM 807..867 CDD:197735
gld-3NP_495479.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10627
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.