DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13243 and Catip

DIOPT Version :8

Sequence 1:NP_001260475.1 Gene:CG13243 / 34933 FlyBaseID:FBgn0028903 Length:405 Species:Drosophila melanogaster
Sequence 2:XP_011236822.1 Gene:Catip / 241112 MGIID:2685062 Length:566 Species:Mus musculus

Alignment Length:356 Identity:74/357 (21%)
Similarity:130/357 (36%) Gaps:109/357 (31%)


  Fly   108 ENLKIFFERELE----------------QIGRF---------CLNVEESFDGYVIFSSSKMKKGK 147
            |::.:||...|.                |.|::         ||.|..|..|::         .|
Mouse    76 EDMLLFFPETLAILSDTGEPQGELTIEVQRGKYKDDIGILTHCLLVHASSRGFL---------DK 131

  Fly   148 GMTECGHQLKGKYDDKFLLICEKRSEFDRIDNTRVEKTLE-LRNHADLMLTAIRETKINEEV--- 208
            .:  ||..|.|..::...|:.:...||.:.....:|:.:. |:.....::|  |..|..||.   
Mouse   132 SL--CGSSLLGYLNNNLELMEQHSQEFIKFPVLPMERKMSVLKQDGQFVVT--RSVKEGEETKTG 192

  Fly   209 ------QRFKARIDIKDRDHVFVLDGGIMLLMRHLVCNNFV-GNFEYYTMNLYGRVLRCNLVVSK 266
                  :.||.          ||.....::|:|.:.....| ....:..::..|::..|      
Mouse   193 VSVFPYKTFKG----------FVSSAANVVLLRVMAWQQSVPSGARFLALDSEGKLCHC------ 241

  Fly   267 ERKEVRIFYRTYKNV----VHIFTQQCFNDELQDVAETFMTPEGRIVLHYWRGYNYLL---HAA- 323
                      |||::    :.:..||.   ::..|.:|..:.||   :.:...| |||   |.| 
Mouse   242 ----------TYKSLGFQTIQVGNQQA---KMFIVEQTIHSEEG---IPFSCQY-YLLPDGHLAK 289

  Fly   324 ---------C----MPPKRKE------PILPKLELMWRQNEQLSRKFRELKALNYENATSYLSSN 369
                     |    ||..|:|      |...|..|:|.::.:|..||.:.|.....:..|||..:
Mouse   290 RVQVGSPGCCIITKMPLIREEDVIESPPTFDKKPLVWGEDLELYSKFLDRKEQLRLSHASYLRHH 354

  Fly   370 SQLADFMQDYVLNLLRYKPSNVLEFSIMFFQ 400
            .:....:.|::|.||..:|.:|:.|:...|:
Mouse   355 PEAQALVSDFLLFLLLRRPEDVVTFAAEHFR 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13243NP_001260475.1 DD_R_PKA 371..404 CDD:295380 8/31 (26%)
CatipXP_011236822.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28H6N
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007609
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.