DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and LCMT2

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_055608.2 Gene:LCMT2 HGNCID:17558 Length:686 Species:Homo sapiens

Alignment Length:304 Identity:113/305 (37%)
Similarity:156/305 (51%) Gaps:9/305 (3%)


  Fly    22 AVIATNDDASDCKRCAVRLGYWKDDYIGYFVRNQERKAPEINRGYFARVKGVEMCVEKFLKKTSG 86
            ||..|||.::..||.....||.:|.:....|....|:||.|:|||:.|.:.|..||..||::...
Human    12 AVQNTNDSSALSKRSLAARGYVQDPFAALLVPGAARRAPLIHRGYYVRARAVRHCVRAFLEQIGA 76

  Fly    87 -----NCQIINLGCGFDTLYFRLRDTAHQVKNFI-ELDFPTVTARKCYTIKRNKALLARIHD-ED 144
                 ..||::||.|||:|||||:......:..: |:|||.|..||...|.....|.|.... |.
Human    77 PQAALRAQILSLGAGFDSLYFRLKTAGRLARAAVWEVDFPDVARRKAERIGETPELCALTGPFER 141

  Fly   145 GEVRLSPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRNLLKW 209
            || ..|........|.::|:|||.|..|:..|..|.:|.:.||:.|||.||.|:|.::...|:.|
Human   142 GE-PASALCFESADYCILGLDLRQLQRVEEALGAAGLDAASPTLLLAEAVLTYLEPESAAALIAW 205

  Fly   210 IAQKFQAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGARAWD 274
            .||:|..|:||.|||:...|.||..||.:.|.....|.|:|....::.||.||..:|||...|.|
Human   206 AAQRFPNALFVVYEQMRPQDAFGQFMLQHFRQLNSPLHGLERFPDVEAQRRRFLQAGWTACGAVD 270

  Fly   275 MVQVYES-ISAAERQRIERLEMLDEGELLLQLFQHYCLVVAWLG 317
            |.:.|.. :.|.||:|:|.:|..||.|.......||.::.|..|
Human   271 MNEFYHCFLPAEERRRVENIEPFDEFEEWHLKCAHYFILAASRG 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 71/196 (36%)
LCMT2NP_055608.2 AdoMet_MTases 28..197 CDD:327401 62/170 (36%)
S-adenosyl-L-methionine binding. {ECO:0000250} 161..162 1/1 (100%)
Kelch_3 493..540 CDD:315978
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2918
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.815465 Normalized mean entropy S2071
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094856at2759
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126898
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2177
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.