DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and PPM2

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_014500.2 Gene:PPM2 SGDID:S000005501 Length:695 Species:Saccharomyces cerevisiae

Alignment Length:353 Identity:85/354 (24%)
Similarity:159/354 (45%) Gaps:37/354 (10%)


  Fly    20 DEAVIATNDDASDCKRCAVRLGYWKD----------------DYIGYFVRNQERKAPEINRGYFA 68
            |.|:..||:.:...|| :|.|.|...                :|..:||..:.:::|.|||||:.
Yeast    24 DLAIQGTNNSSIASKR-SVELLYLPKLSSANNFQMDKNNKLLEYFKFFVPKKIKRSPCINRGYWL 87

  Fly    69 RVKGVEMCVEKFLKKTSGNCQI--INLGCGFDTLYFRLRDT-------AHQVKNFIELDFPTVTA 124
            |:..:...:...:::|..:.:|  :|||||:|.|.|:|.||       .|...:||::|:..:..
Yeast    88 RLFAIRSRLNSIIEQTPQDKKIVVVNLGCGYDPLPFQLLDTNNIQSQQYHDRVSFIDIDYSDLLK 152

  Fly   125 RKCYTIKRNKAL--LARIHDEDGEVRLSPTD-LHGPSYHLMGVDLRNLDEVDSKLQQAEV-DYSL 185
            .|...||....|  :..:.::...|..|..| |..|.|.....||.:.....:.|.:.:: |.::
Yeast   153 IKIELIKTIPELSKIIGLSEDKDYVDDSNVDFLTTPKYLARPCDLNDSKMFSTLLNECQLYDPNV 217

  Fly   186 PTIFLAECVLVYIEAQNCRNLLKWIAQKFQAAVFVNYEQV---NMNDRFGDVMLNNLRGRGCSLA 247
            ..:|:||..|.|::.:...:::: ...|.:.:.|:..||:   ...:.|...||.:.:.....|.
Yeast   218 VKVFVAEVSLAYMKPERSDSIIE-ATSKMENSHFIILEQLIPKGPFEPFSKQMLAHFKRNDSPLQ 281

  Fly   248 GVESCLSLDTQRNRFKDSGWTGARAWDMVQVYESISAAERQRIERLEMLDEGELLLQLFQHYCLV 312
            .|....::::|..||...|:......||.|::||...|.::.:.::|..||.|.......||.|.
Yeast   282 SVLKYNTIESQVQRFNKLGFAYVNVGDMFQLWESADEATKKELLKVEPFDELEEFHLFCHHYVLC 346

  Fly   313 VAWLGVAFQDIDITCVPVVEELMSSLNI 340
            .|   ..:::...|...:.:..:|.:|:
Yeast   347 HA---TNYKEFAFTQGFLFDRSISEINL 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 54/218 (25%)
PPM2NP_014500.2 AdoMet_MTases 21..241 CDD:302624 55/219 (25%)
Kelch_4 439..486 CDD:290154
KELCH repeat 440..487 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2918
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0.815465 Normalized mean entropy S2071
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126898
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2177
TreeFam 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.