DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and PPM1

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_010723.1 Gene:PPM1 SGDID:S000002843 Length:328 Species:Saccharomyces cerevisiae

Alignment Length:337 Identity:84/338 (25%)
Similarity:148/338 (44%) Gaps:52/338 (15%)


  Fly    21 EAVIATND-DASDCKRCAVRLGY-------------------WKDDYIGYFVRNQERKA------ 59
            |.:|...| ||..||..|:.:||                   |...|: ..::...|:|      
Yeast     2 ERIIQQTDYDALSCKLAAISVGYLPSSGLQRLSVDLSKKYTEWHRSYL-ITLKKFSRRAFGKVDK 65

  Fly    60 ------PEINRGYFARVKGVEMCVEKFLKKTSGNCQIINLGCGFDTLYFRLRDTAHQVKNFIELD 118
                  |.:|.|.:.|..|::..:.:|| ..:...|::|||||.|.....|......:. ::::|
Yeast    66 AMRSSFPVMNYGTYLRTVGIDAAILEFL-VANEKVQVVNLGCGSDLRMLPLLQMFPHLA-YVDID 128

  Fly   119 FPTVTARKCYTIKRNKALLARIHDEDGEVRLSPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDY 183
            :......|...::.::.|...:.....:...||..:....|.|...||.::.|. ::|.......
Yeast   129 YNESVELKNSILRESEILRISLGLSKEDTAKSPFLIDQGRYKLAACDLNDITET-TRLLDVCTKR 192

  Fly   184 SLPTIFLAECVLVYIEAQNCRNLLKWIAQKFQAAVFVNYEQV---NMNDRFGDVMLNNLR-GRGC 244
            .:|||.::||:|.|:.....:.|:..|..||...::::|:.:   ..|||||.:|.:||: .|..
Yeast   193 EIPTIVISECLLCYMHNNESQLLINTIMSKFSHGLWISYDPIGGSQPNDRFGAIMQSNLKESRNL 257

  Fly   245 SLAGVESCLSLDTQRNRFK-DSGWTGAR---AWDMVQVYES-ISAAERQRIERLEMLDEGELLLQ 304
            .:.      :|.|..::.| .|.|:.|.   ..||.:::.: |..:||:|:..|:.|||.|.|..
Yeast   258 EMP------TLMTYNSKEKYASRWSAAPNVIVNDMWEIFNAQIPESERKRLRSLQFLDELEELKV 316

  Fly   305 LFQHYCLVVA-W 315
            :..||.|:.| |
Yeast   317 MQTHYILMKAQW 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 48/221 (22%)
PPM1NP_010723.1 LCM 5..220 CDD:309269 48/219 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C221770911
eggNOG 1 0.900 E1_KOG2918
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I1552
Isobase 1 0.950 0.815465 Normalized mean entropy S2071
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 1 1.000 T1135573
orthoMCL 1 0.900 OOG5_126898
Panther 1 1.100 LDO PTHR13600
Phylome 1 0.910 0.646 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2177
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.