DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and SBI1

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_171712.2 Gene:SBI1 AraportID:AT1G02100 Length:332 Species:Arabidopsis thaliana

Alignment Length:327 Identity:130/328 (40%)
Similarity:191/328 (58%) Gaps:19/328 (6%)


  Fly    22 AVIATNDDASDCKRCAVRLGYWKDDYIGYFVRNQERKAPEINRGYFARVKGVEMCVEKF-LKKTS 85
            ||.|||||||..|...|:.||.||||:..||:...|::|.||||||:|.......:.:| |..||
plant    10 AVQATNDDASASKLSCVKKGYMKDDYVHLFVKRPVRRSPIINRGYFSRWAAFRKLMSQFLLSGTS 74

  Fly    86 GNCQIINLGCGFDTLYFRLRDTAHQVKNFIELDFPTVTARKCYTIKRNKALL------ARIHDED 144
            ...||::||.||||.||:|.|..:....::||||..||::|...|:.:..|.      |.|..::
plant    75 SKKQILSLGAGFDTTYFQLLDEGNGPNLYVELDFKEVTSKKAAVIQNSSQLRDKLGANASISIDE 139

  Fly   145 GEVRLSPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRNLLKW 209
            |:| ||      ..|.|:.||||::.::...:..|::|.||||..:|||||:|::..:.|.::.|
plant   140 GQV-LS------DHYKLLPVDLRDIPKLRDVISFADMDLSLPTFIIAECVLIYLDPDSSRAIVNW 197

  Fly   210 IAQKFQAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGARAWD 274
            .::.|..|||..|||::.:|.||..|:.||..|||:|..:::..:|..:...|.|:||..|.|||
plant   198 SSKTFSTAVFFLYEQIHPDDAFGHQMIRNLESRGCALLSIDASPTLLAKERLFLDNGWQRAVAWD 262

  Fly   275 MVQVYES-ISAAERQRIERLEMLDEGELLLQLFQHYCLVVA---WLGVAFQDIDITCVPVVEELM 335
            |::||.| :...|::||||||:.||.|....:.:|||:..|   .:|: |.|...|.....|.:.
plant   263 MLKVYGSFVDTQEKRRIERLELFDEFEEWHMMQEHYCVTYAVNDAMGI-FGDFGFTREGGGERMS 326

  Fly   336 SS 337
            ||
plant   327 SS 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 79/196 (40%)
SBI1NP_171712.2 AdoMet_MTases 18..197 CDD:327401 71/186 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H41123
Inparanoid 1 1.050 223 1.000 Inparanoid score I1158
OMA 1 1.010
OrthoDB 1 1.010 D1094856at2759
OrthoInspector 1 1.000 T193582
orthoMCL 1 0.900 OOG5_126898
Panther 1 1.100 LDO PTHR13600
Phylome 1 0.910 0.641 Consistency score
98.980

Return to query results.
Submit another query.