DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and lcmt1

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001016033.1 Gene:lcmt1 XenbaseID:XB-GENE-5811952 Length:326 Species:Xenopus tropicalis

Alignment Length:329 Identity:158/330 (48%)
Similarity:208/330 (63%) Gaps:17/330 (5%)


  Fly     1 MEPPASAGIAGSTHKFHPCDEAVIATNDDASDCKRCAVRLGYWKDDYIGYFVRN-QERKAPEINR 64
            |..||..|....|     .||||..|.||||.|||.||..|||||.||.||||. :|||||||||
 Frog     1 MSKPAGPGPDSDT-----ADEAVRGTCDDASICKRFAVSAGYWKDPYIQYFVRQAKERKAPEINR 60

  Fly    65 GYFARVKGVEMCVEKFLKKTSGNCQIINLGCGFDTLYFRLRDTAHQVKNFIELDFPTVTARKCYT 129
            ||:|||:||.:.::.||:||..||||||||.|.||.::||:|.....|.:.|:|||.:.|||.|.
 Frog    61 GYYARVQGVHLLLKAFLRKTECNCQIINLGAGLDTTFWRLKDENLLPKKYFEVDFPAIVARKLYN 125

  Fly   130 IKRNKALLARIHD-EDGE-VRLSPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAE 192
            ||....|...|.: ..|| :.|....|....|.::|.||||..:::.||::..:|..|||:.:.|
 Frog   126 IKSKPPLSKPIMETHSGESLLLDAHSLDSARYSIIGADLRNPKDMEEKLKKMSLDPQLPTLLVTE 190

  Fly   193 CVLVYIEAQNCRNLLKWIAQKFQAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDT 257
            |||||:..:...:||:|....|..|:|:|||||||.||||.:|:.||:.|.|:||||::|.||::
 Frog   191 CVLVYMTPEQSASLLQWATNTFTTAMFINYEQVNMMDRFGQIMVENLQRRQCNLAGVDACQSLES 255

  Fly   258 QRNRFKDSGWTGARAWDMVQVYESISAAERQRIERLEMLDEGELLLQLFQHYCLVVAW------- 315
            |..|...:||..|.||:|::||.::...:..|||:||.|||.|||.||..|||  ::|       
 Frog   256 QTERLLSTGWESADAWNMMKVYSNLPQEDVMRIEKLEFLDEKELLEQLLLHYC--ISWATKDSLG 318

  Fly   316 LGVA 319
            ||:|
 Frog   319 LGLA 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 95/192 (49%)
lcmt1NP_001016033.1 LCM 17..209 CDD:281992 95/192 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41123
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1094856at2759
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.