DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and LCMT1

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_011544166.1 Gene:LCMT1 HGNCID:17557 Length:357 Species:Homo sapiens

Alignment Length:288 Identity:141/289 (49%)
Similarity:192/289 (66%) Gaps:5/289 (2%)


  Fly    34 KRCAVRLGYWKDDYIGYFVR-NQERKAPEINRGYFARVKGVEMCVEKFLKKTSGNCQIINLGCGF 97
            :|.||.:|||.|.||.:||| ::|||||||||||||||.||...::.||:||..:|||:|||.|.
Human    60 RRFAVSIGYWHDPYIQHFVRLSKERKAPEINRGYFARVHGVSQLIKAFLRKTECHCQIVNLGAGM 124

  Fly    98 DTLYFRLRDTAHQVKNFIELDFPTVTARKCYTIKRNKAL---LARIHDEDGEVRLSPTDLHGPSY 159
            ||.::||:|.......:.|:|||.:..||.::||....|   :..:|.|| .:::....|....|
Human   125 DTTFWRLKDEDLLPSKYFEVDFPMIVTRKLHSIKCKPPLSSPILELHSED-TLQMDGHILDSKRY 188

  Fly   160 HLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRNLLKWIAQKFQAAVFVNYEQ 224
            .::|.|||:|.|::.||::..::..|||:.:|||||||:..:...|||||.|..|:.|:|:||||
Human   189 AVIGADLRDLSELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQ 253

  Fly   225 VNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGARAWDMVQVYESISAAERQR 289
            |||.||||.:|:.|||.|.|.|||||:|.||::|:.|...:||..|.|.||:::|..:..||..|
Human   254 VNMGDRFGQIMIENLRRRQCDLAGVETCKSLESQKERLLSNGWETASAVDMMELYNRLPRAEVSR 318

  Fly   290 IERLEMLDEGELLLQLFQHYCLVVAWLG 317
            ||.||.|||.|||.||.:||||..|..|
Human   319 IESLEFLDEMELLEQLMRHYCLCWATKG 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 82/181 (45%)
LCMT1XP_011544166.1 LCM 67..240 CDD:309269 79/174 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C221761036
eggNOG 1 0.900 E1_KOG2918
Hieranoid 1 1.000
Homologene 1 1.000 H41123
Inparanoid 1 1.050 295 1.000 Inparanoid score I2716
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1094856at2759
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 1 1.000 T1072393
orthoMCL 1 0.900 OOG5_126898
Panther 1 1.100 LDO PTHR13600
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2177
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.