DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3793 and lcmt1

Sequence 1:NP_001246038.1 Gene:CG3793 FlyBaseID:FBgn0028507 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001004645.1 Gene:lcmt1 ZFINID:ZDB-GENE-040912-75 Length:325 Species:Danio rerio

Alignment Length:300 Identity:151/300 (50%)
Similarity:197/300 (66%) Gaps:7/300 (2%)


  Fly    20 DEAVIATNDDASDCKRCAVRLGYWKDDYIGYFVRN-QERKAPEINRGYFARVKGVEMCVEKFLKK 83
            ||||.||.||||.|||.|...|||.|.|:.||||. .|||||||||||:.||||:.:.::.||||
Zfish    14 DEAVRATCDDASICKRFATSKGYWTDLYVQYFVRQIGERKAPEINRGYYGRVKGMNLLLDDFLKK 78

  Fly    84 TSGNCQIINLGCGFDTLYFRLRDTAHQVKNFIELDFPTVTARKCYTIKRNKAL---LARIHDEDG 145
            |..:||::|||.|.||.::||:|.....|.|.|:|||.:.|||.:.||....|   |...|..| 
Zfish    79 TQCDCQVVNLGAGLDTTFWRLKDENVMPKKFFEVDFPMIVARKIHNIKTKPPLSKPLIETHSTD- 142

  Fly   146 EVRLSPTDLHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRNLLKWI 210
            .:.|....|....|.::|.|||::..::.||::.:::..|||:||:||||||:..:....|:.||
Zfish   143 SLLLDGHSLDSDRYCIIGADLRDIPTLEDKLKKFQINPELPTLFLSECVLVYMSPEQSSRLVHWI 207

  Fly   211 AQKFQAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGARAWDM 275
            |:.|..|:|:||||||||||||.:|:.||:.|.|:||||:.|.|||:|:.||..|||....|.||
Zfish   208 AETFPTAMFINYEQVNMNDRFGHIMIENLQRRQCNLAGVDLCQSLDSQKERFLSSGWESVNALDM 272

  Fly   276 VQVYESISAAERQRIERLEMLDEGELLLQLFQHYCLVVAW 315
            :.||..:...:..||||||.|||.|||.||.||||  :.|
Zfish   273 MTVYSMLPQEDVARIERLEFLDEKELLQQLLQHYC--ICW 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3793NP_001246038.1 LCM 22..211 CDD:281992 90/193 (47%)
lcmt1NP_001004645.1 LCM 16..208 CDD:281992 90/193 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C221761752
eggNOG 1 0.900 E1_KOG2918
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H41123
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1094856at2759
OrthoFinder 1 1.000 FOG0001304
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126898
Panther 1 1.100 LDO PTHR13600
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.